Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Clear cell sarcoma of kidney 6
Disease Target Count Z-score Confidence
clear cell sarcoma 6 4.698 2.3

Expression

Gene RIF (1)

AA Sequence

MEVKGPSGRSFCCESEGQFKSCLKRHTPSLLLPSSWKGNSGSCLMAEALHRTSPTPNSCPLPLPLCRMSG      1 - 70
VLCSRNLFTFKFSLFQLDSGASGEPGHSLGLTLGFSYCGNCQTAVVSAQPEGMASNGAYPVLGPGVTANP     71 - 140
GTSLSVFTALPFTTPAPGPAHGPLLVTAGAPPGGPLVLSTFPSTPLVTEQDGCSPSGAGASNVFVQMRTE    141 - 210
VGPVKAAQAQTLVLTQAPLVWQAPGALCGGVVCPPPLLLAAAPVVPVMAAQVVGGTQACEGGWSQGLPLP    211 - 280
PPPPPAAQLPPIVSQGNAGPWPQGAHGESSLASSQAKAPPDDSCNPRSVYENFRLWQHYKPLARRHLPQS    281 - 350
PDTEALSCFLIPVLRSLARRKPTMTLEEGLWRAMREWQHTSNFDRMIFYEMAEKFLEFEAEEEMQIQKSQ    351 - 420
WMKGPQCLPPPATPRLEPRGPPAPEVVKQPVYLPSKAGPKAQTACLPPPRPQRPVTKARRPPPQPHRRAE    421 - 490
TKARLPPPRPQRPAETKVPEEIPPEVVQEYVDIMEELLGPSLGATGEPEKQREEGKVKQPQEEDWTPPDP    491 - 560
GLLSYIDKLCSQKDFVTKVEAVIHPQFLEELLSPDPQMDFLALSQDLEQEEGLTLAQLVEKRLPPLKEKQ    561 - 630
HSRAAPSRGTARLDSSSSKFAAGQGAERDVPDPQEGVGMETCPPQTTARDSQGRGRAHTGMARSEDSVVL    631 - 700
LGCQDSPGLRAARPTSPPQDHRPTCPGVGTKDALDLPGGSPVRESHGLAQGSSEEEELPSLAFLLGSQHK    701 - 770
LLPWWLPQSPVPASGLLSPEKWGPQGTHQSPSAERRGLNLAPSPANKAKKQPLFGSLSPAEKTPHRGPGL    771 - 840
RVSGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQHCSQ                                    841 - 878
//

Text Mined References (3)

PMID Year Title