Property Summary

NCBI Gene PubMed Count 111
Grant Count 631
R01 Count 253
Funding $152,119,833.74
PubMed Score 2078.35
PubTator Score 966.18

Knowledge Summary

Patent

No data available

Synonym

Accession B1AH88 Q13849 Q6IAZ7
Symbols DBI
IBP
MBR
PBR
PBS
BPBS
BZRP
PKBS
PTBR
mDRC
pk18

Gene

Gene RIF (96)

PMID Text
27054921 This work implicates TSPO in the maintenance of mitochondrial membrane integrity and in the control of mitochondrial ROS production, ultimately favoring tissue regeneration.
26898800 We conclude that ScBsAbAgn-2/TSPO targeting of glioblastoma cell lines can be achieved in vitro and in vivo.
26835706 the effects of PK11195 on meningioma were associated the decrease of allopregnanolone biosynthesis, which was mediated by TSPO.
26608360 Study demonstrates that TSPO has an anti-inflammatory role in endothelial activation through the inhibition of VCAM1 and regulation of mitochondrial function in endothelial cells.
26551696 Studies confirmed that TSPO expression increases with tumor grade in astrocytomas but also that some overlap exists between Low-grade and anaplastic lesions.
26551695 The authors discuss findings about TSPO and its function in the steroidogenesis which are inconclusive at this time. [Review]
26551691 Study focuses on the current understanding of TSPO interplay with reactive oxygen species and the voltage-dependent anion channel to which it binds, in the regulation of cell mitophagy. [review]
26517124 Study show that TSPO is highly expressed in human glioma and correlates with grade and represents a promising target in human glioma imaging for detection and staging.
26472628 Elevations in microglial activity can be measured in vivo with positron emission tomography (PET) using radioligands specific for the 18kD translocator-protein (TSPO), which is expressed on microglia.
26182972 Our preliminary results suggest that TSPO brain imaging in GBM may be a useful tool for predicting tumor progression at follow-up and may be less susceptible to changes in blood-brain barrier permeability than (18)F-FET.
More...

AA Sequence

MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLRMAGQPWLAWG      1 - 70
TAAARVSARPTRDCSCTSRCHHACDVVAVTLS                                           71 - 102
//

Text Mined References (111)

PMID Year Title
27054921 2016 Translocator Protein-Mediated Stabilization of Mitochondrial Architecture during Inflammation Stress in Colonic Cells.
26898800 2016 A bispecific antibody (ScBsAbAgn-2/TSPO) target for Ang-2 and TSPO resulted in therapeutic effects against glioblastomas.
26835706 2016 The effects of PK11195 on meningioma was associated with allopregnanolone biosynthesis, which was mediated by translocator protein 18 KDa.
26608360 2015 The 18-kDa Translocator Protein Inhibits Vascular Cell Adhesion Molecule-1 Expression via Inhibition of Mitochondrial Reactive Oxygen Species.
26551696 2015 The 18-kDa mitochondrial translocator protein in gliomas: from the bench to bedside.
26551695 2015 Translocator protein: pharmacology and steroidogenesis.
26551691 2015 TSPO is a REDOX regulator of cell mitophagy.
26517124 2015 Preclinical TSPO Ligand PET to Visualize Human Glioma Xenotransplants: A Preliminary Study.
26472628 2016 Microglial Activity in People at Ultra High Risk of Psychosis and in Schizophrenia: An [(11)C]PBR28 PET Brain Imaging Study.
26182972 2015 TSPO Imaging in Glioblastoma Multiforme: A Direct Comparison Between 123I-CLINDE SPECT, 18F-FET PET, and Gadolinium-Enhanced MR Imaging.
More...