Property Summary

NCBI Gene PubMed Count 125
PubMed Score 2284.19
PubTator Score 966.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.400 1.4e-03
astrocytoma 1.100 5.2e-03
Astrocytoma, Pilocytic 1.800 6.6e-08
atypical teratoid / rhabdoid tumor 1.200 1.1e-03
ependymoma 1.500 4.5e-07
glioblastoma 1.700 4.4e-08
group 4 medulloblastoma -1.100 1.4e-03
intraductal papillary-mucinous adenoma (... 1.400 2.0e-04
malignant mesothelioma -2.800 3.6e-08
osteosarcoma -1.149 4.8e-03
ovarian cancer -1.100 3.6e-03
pancreatic cancer 1.100 2.4e-05
psoriasis 1.400 2.1e-04
subependymal giant cell astrocytoma 1.402 2.8e-02
tuberculosis 1.800 1.8e-08
Waldenstrons macroglobulinemia 1.109 2.9e-02

Synonym

Accession B1AH88 Q13849 Q6IAZ7
Symbols DBI
IBP
MBR
PBR
PBS
BPBS
BZRP
PKBS
PTBR
mDRC
pk18

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (108)

AA Sequence

MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLRMAGQPWLAWG      1 - 70
TAAARVSARPTRDCSCTSRCHHACDVVAVTLS                                           71 - 102
//

Text Mined References (125)

PMID Year Title