Property Summary

NCBI Gene PubMed Count 19
PubMed Score 29.52
PubTator Score 27.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.064 3.9e-02
astrocytic glioma -1.600 2.0e-02
Chronic Lymphocytic Leukemia 1.028 9.2e-05
colon cancer -2.000 6.3e-05
Duchenne muscular dystrophy 1.109 4.0e-04
ependymoma -1.900 2.2e-02
hereditary spastic paraplegia -1.527 5.0e-03
lung cancer -1.600 9.3e-04
lung carcinoma -1.500 2.4e-24
non-small cell lung cancer -1.494 2.1e-11
oligodendroglioma -1.500 2.1e-02
ovarian cancer -2.600 5.7e-08
psoriasis 1.500 1.3e-02

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MGRLTEAAAAGSGSRAAGWAGSPPTLLPLSPTSPRCAATMASSDEDGTNGGASEAGEDREAPGERRRLGV      1 - 70
LATAWLTFYDIAMTAGWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEIVHCLIGIVPTSVIV     71 - 140
TGVQVSSRIFMVWLITHSIKPIQNEESVVLFLVAWTVTEITRYSFYTFSLLDHLPYFIKWARYNFFIILY    141 - 210
PVGVAGELLTIYAALPHVKKTGMFSIRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHG    211 - 280
EVIVEKDD                                                                  281 - 288
//

Text Mined References (21)

PMID Year Title