Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
Funding $433,030
PubMed Score 28.67
PubTator Score 27.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.028 0.000
astrocytic glioma -1.600 0.020
ependymoma -1.900 0.022
oligodendroglioma -1.500 0.021
psoriasis 1.500 0.013
Duchenne muscular dystrophy 1.109 0.000
hereditary spastic paraplegia -1.527 0.005
adrenocortical carcinoma -1.064 0.039
non-small cell lung cancer -1.494 0.000
lung cancer -2.100 0.000
colon cancer -2.000 0.000
lung carcinoma -1.500 0.000
ovarian cancer -2.600 0.000

Synonym

Accession B0YJ81 B0YJ80 Q6JIC5 Q96FW7 Q9HB93 Q9UHX2
Symbols CAP
PTPLA

Gene

Gene RIF (7)

PMID Text
23933735 These data indicate that HACD1 is necessary for muscle function.
22067203 PTPLA-CAP expression was limited to cementum cells; promoted gingival fibroblast attachment. PTPLA-CAP is splice variant of PTPLA, and that, in the periodontium, cementum and cementum cells express this variant.
20724468 HACD1 is 3-hydroxyacyl-CoA dehydratase involved in elongation of very long-chain fatty acids. HACD1 (K64Q) exhibits normal enzyme activity, intracellular localization and interaction with other VLCFA enzymes, with no negative effect on VLCFA elongation
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19241460 PTPLA SNPs show genotypic association with Alzheimer disease.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRLTEAAAAGSGSRAAGWAGSPPTLLPLSPTSPRCAATMASSDEDGTNGGASEAGEDREAPGERRRLGV      1 - 70
LATAWLTFYDIAMTAGWLVLAIAMVRFYMEKGTHRGLYKSIQKTLKFFQTFALLEIVHCLIGIVPTSVIV     71 - 140
TGVQVSSRIFMVWLITHSIKPIQNEESVVLFLVAWTVTEITRYSFYTFSLLDHLPYFIKWARYNFFIILY    141 - 210
PVGVAGELLTIYAALPHVKKTGMFSIRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHG    211 - 280
EVIVEKDD                                                                  281 - 288
//

Text Mined References (17)

PMID Year Title
25263524 2014 Human recombinant cementum attachment protein (hrPTPLa/CAP) promotes hydroxyapatite crystal formation in vitro and bone healing in vivo.
23933735 2013 Congenital myopathy is caused by mutation of HACD1.
22067203 2012 Isolation of protein-tyrosine phosphatase-like member-a variant from cementum.
20724468 2010 Characterization of HACD1 K64Q mutant found in arrhythmogenic right ventricular dysplasia patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19241460 2009 Genomic convergence to identify candidate genes for Alzheimer disease on chromosome 10.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18554506 2008 Characterization of four mammalian 3-hydroxyacyl-CoA dehydratases involved in very long-chain fatty acid synthesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...