Property Summary

NCBI Gene PubMed Count 16
PubMed Score 98.26
PubTator Score 40.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Leukemia 104 4.251 2.1

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.400 2.1e-03
chronic lymphosyte leukemia -1.100 3.1e-05
interstitial cystitis 1.100 6.6e-04
interstitial lung disease 1.400 2.4e-02
lung adenocarcinoma 1.100 2.7e-03
lung carcinoma -1.500 4.2e-20
non-small cell lung cancer -1.070 4.4e-09
osteosarcoma -1.517 7.6e-03
ovarian cancer -1.300 1.4e-04

Gene RIF (6)

AA Sequence

MEDEEGPEYGKPDFVLLDQVTMEDFMRNLQLRFEKGRIYTYIGEVLVSVNPYQELPLYGPEAIARYQGRE      1 - 70
LYERPPHLYAVANAAYKAMKHRSRDTCIVISGESGAGKTEASKHIMQYIAAVTNPSQRAEVERVKDVLLK     71 - 140
STCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPIGGHIHSYLLEKSRVLKQHVGERNFHAFYQLLRG    141 - 210
SEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAIL    211 - 280
HLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASY    281 - 350
ARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRDGKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQ    351 - 420
QLFIQLILKQEQEEYEREGITWQSVEYFNNATIVDLVERPHRGILAVLDEACSSAGTITDRIFLQTLDMH    421 - 490
HRHHLHYTSRQLCPTDKTMEFGRDFRIKHYAGDVTYSVEGFIDKNRDFLFQDFKRLLYNSTDPTLRAMWP    491 - 560
DGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVRCIKPNEDKVAGKLDENHCRHQVAYLGLLEN    561 - 630
VRVRRAGFASRQPYSRFLLRYKMTCEYTWPNHLLGSDKAAVSALLEQHGLQGDVAFGHSKLFIRSPRTLV    631 - 700
TLEQSRARLIPIIVLLLQKAWRGTLARWRCRRLRAIYTIMRWFRRHKVRAHLAELQRRFQAARQPPLYGR    701 - 770
DLVWPLPPAVLQPFQDTCHALFCRWRARQLVKNIPPSDMPQIKAKVAAMGALQGLRQDWGCRRAWARDYL    771 - 840
SSATDNPTASSLFAQRLKTLQDKDGFGAVLFSSHVRKVNRFHKIRNRALLLTDQHLYKLDPDRQYRVMRA    841 - 910
VPLEAVTGLSVTSGGDQLVVLHARGQDDLVVCLHRSRPPLDNRVGELVGVLAAHCQGEGRTLEVRVSDCI    911 - 980
PLSHRGVRRLISVEPRPEQPEPDFRCARGSFTLLWPSR                                    981 - 1018
//

Text Mined References (17)

PMID Year Title