Property Summary

NCBI Gene PubMed Count 15
PubMed Score 95.26
PubTator Score 40.07

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.15237926325698E-20
non-small cell lung cancer 2798 5.15380245837802E-14
chronic lymphosyte leukemia 232 3.06262331122847E-5
ovarian cancer 8492 1.36263515210608E-4
interstitial cystitis 2299 0.00188233240697328
acute myeloid leukemia 785 0.00205803821236507
lung adenocarcinoma 2714 0.00265469924040399
osteosarcoma 7933 0.00758046206629277
interstitial lung disease 292 0.0240970167234227
Disease Target Count Z-score Confidence
Leukemia 88 4.189 2.1


  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.400 0.024
osteosarcoma -1.517 0.008
chronic lymphosyte leukemia -1.100 0.000
non-small cell lung cancer -1.847 0.000
interstitial cystitis 1.900 0.002
lung adenocarcinoma 1.100 0.003
lung carcinoma -1.500 0.000
acute myeloid leukemia 1.400 0.002
ovarian cancer -1.300 0.000


Accession B0I1T2 Q8TEI9 Q8TES2 Q96BE2 Q96RI5 Q96RI6
Symbols HA2


  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
C. elegans OMA Inparanoid

Gene RIF (5)

23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of myosin IG (MYO1G) expression by HIV-1 Vpr in Vpr transduced macrophages
20653428 gene polymorphism does not have any significant effect on the occurrence of GVHD in Tunisia
20509834 the information on allele and genotype frequencies of HA-1 and HA-2 in a Taiwanese population
20353833 Observational study of gene-disease association. (HuGE Navigator)
20071333 Myosin 1G is an abundant class I myosin in lymphocytes whose localization at the plasma membrane depends on its ancient divergent pleckstrin homology (PH) domain

AA Sequence

PLSHRGVRRLISVEPRPEQPEPDFRCARGSFTLLWPSR                                    981 - 1018

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20653428 2010 Mismatch for the minor histocompatibility antigen HA-2 and GVHD occurrence in HLA-A*0201-positive Tunisian recipients of HSCs.
20509834 2010 Minor histocompatibility antigen HA-1 and HA-2 polymorphisms in Taiwan: frequency and application in hematopoietic stem cell transplantation.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20353833 2010 Degree of predicted minor histocompatibility antigen mismatch correlates with poorer clinical outcomes in nonmyeloablative allogeneic hematopoietic cell transplantation.
20071333 2010 Myosin 1G is an abundant class I myosin in lymphocytes whose localization at the plasma membrane depends on its ancient divergent pleckstrin homology (PH) domain (Myo1PH).
19968988 2010 Myosin 1G (Myo1G) is a haematopoietic specific myosin that localises to the plasma membrane and regulates cell elasticity.
19946888 2010 Defining the membrane proteome of NK cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).