Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.4e-02

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 2.4e-02

AA Sequence

MDNSWRLGPAIGLSAGQSQLLVSLLLLLTRVQPGTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLG      1 - 70
QFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGN     71 - 140
DTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVVIIAILS    141 - 210
ILLAVLLTVLLAVLIYTCFNSCRSTSLSGPEEAGSVRRYTTHLAFSTPAEGAS                     211 - 263
//

Text Mined References (2)

PMID Year Title