Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.11
PubTator Score 18.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.095 1.8e-02
chronic lymphocytic leukemia 1.078 1.8e-02
Multiple myeloma 1.016 1.7e-02
osteosarcoma 1.011 1.4e-02
posterior fossa group A ependymoma 1.400 1.2e-08
hereditary spastic paraplegia -1.085 8.5e-03
acute quadriplegic myopathy 1.039 1.5e-03
lung cancer 1.200 2.5e-04
Breast cancer 3.300 2.6e-02
aldosterone-producing adenoma -1.334 1.9e-02
lung adenocarcinoma 1.281 1.2e-07
invasive ductal carcinoma 1.300 2.5e-03
ovarian cancer 1.500 4.5e-03
dermatomyositis 1.100 2.8e-03

Synonym

Accession O14977 A6NCD5 Q6IBQ7 Q96D20 AZI
Symbols AZI
OAZI
AZIA1
OAZIN
ODC1L

Gene

PANTHER Protein Class (2)

PDB

4ZGZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (8)

Gene RIF (9)

PMID Text
26305948 Data show the the interplay between the enzyme ornithine decarboxylase (ODC) and two regulatory proteins: antizyme (Az) and inhibitor (AzIN).
25813938 AzI1 fulfils an essential regulatory function in polyamine homeostasis and cell proliferation.
23844940 AZIN1 rs2679757 and TRPM5 rs886277 are associated with the risk of HBV-related liver cirrhosis in Chinese.
23291631 edited form has a stronger affinity to antizyme, and the resultant higher AZIN1 protein stability promotes cell proliferation through the neutralization of antizyme-mediated degradation of ornithine decarboxylase (ODC) and cyclin D1
21931692 AZ_95-176 is the minimal AZ peptide that is fully functioning in the binding of ODC and AZI and inhibition of their function.
21837750 minor allelic SNP variant in 12th exon of AZIN1 associated with slower rates of fibrosis progression favors expression of novel splice form, AZIN1 SV2, that inhibits expression of fibrogenic genes in hepatic stellate cells.
21586232 SNP rs2679757 in the AZIN1 gene is associated with the risk of HBV-related liver cirrhosis in Chinese patients.
20215859 Decreased ornithine decarboxylase is associated with prostate cancer.
15670771 This study also suggests that highly expressed AZI may be partly responsible for increased ODC activity and cellular transformation.

AA Sequence

MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVAQIKPFYTVKC      1 - 70
NSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELK     71 - 140
KIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVH    141 - 210
ALSDARCVFDMAGEIGFTMNMLDIGGGFTGTEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSA    211 - 280
FTLAVNIIAKKVVENDKFPSGVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFT    281 - 350
SSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI    351 - 420
TSDSMMKNFFFVPSCIQLSQEDSFSAEA                                              421 - 448
//

Text Mined References (25)

PMID Year Title
26305948 2015 Structural basis of antizyme-mediated regulation of polyamine homeostasis.
25813938 2015 A role for antizyme inhibitor in cell proliferation.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25416956 2014 A proteome-scale map of the human interactome network.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
23844940 2013 A candidate gene study for the association of host single nucleotide polymorphisms with liver cirrhosis risk in chinese hepatitis B patients.
23291631 2013 Recoding RNA editing of AZIN1 predisposes to hepatocellular carcinoma.
21931692 2011 Minimal antizyme peptide fully functioning in the binding and inhibition of ornithine decarboxylase and antizyme inhibitor.
21837750 2011 A polymorphism that delays fibrosis in hepatitis C promotes alternative splicing of AZIN1, reducing fibrogenesis.
21586232 2011 [Polymorphism of ornithine decarboxylase antizyme inhibitor 1 gene is associated with liver cirrhosis in Chinese hepatitis B patients].
20217058 2010 Recurrent emergence of catalytically inactive ornithine decarboxylase homologous forms that likely have regulatory function.
20215859 2010 Assessing prostate cancer growth with mRNA of spermine metabolic enzymes.
19920120 2010 A profusion of upstream open reading frame mechanisms in polyamine-responsive translational regulation.
18508777 2008 Antizyme inhibitor 2 (AZIN2/ODCp) stimulates polyamine uptake in mammalian cells.
17900240 2008 Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15670771 2005 Stable siRNA-mediated silencing of antizyme inhibitor: regulation of ornithine decarboxylase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9349715 1997 Cloning and sequencing of a human cDNA encoding ornithine decarboxylase antizyme inhibitor.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.