Property Summary

NCBI Gene PubMed Count 94
PubMed Score 164.12
PubTator Score 192.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -2.081 3.6e-02
psoriasis -1.100 1.1e-03
ependymoma 1.300 1.8e-02
glioblastoma 1.900 9.8e-04
ulcerative colitis 2.900 1.0e-04
primary pancreatic ductal adenocarcinoma -2.697 1.3e-03
intraductal papillary-mucinous adenoma (... -1.600 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.800 3.4e-02
fibroadenoma 2.700 1.2e-02
interstitial cystitis -2.600 5.4e-04
cystic fibrosis -3.100 1.4e-04
lung adenocarcinoma 1.200 5.0e-03
adult high grade glioma 1.900 7.7e-04
pilocytic astrocytoma 4.500 1.0e-07
lung carcinoma 1.700 9.4e-06
Breast cancer -2.400 1.5e-03
chronic rhinosinusitis 3.624 1.1e-02
pancreatic cancer -2.900 2.1e-03

Gene RIF (57)

PMID Text
26487699 It was concluded that the lipid-binding groove in ZA2G contains at least two distinct fatty acid-binding sites.
26383228 reduced AZGP1 expression is strongly related to adverse prostate cancer prognosis, independently of established clinic-pathological variables and PTEN deletions.
26068931 Zinc-alpha2-glycoprotein inhibits insulin-induced glucose uptake in human adipocytes by impairing insulin signaling at the level of AKT in a PP2A-dependent manner.
25788525 AZGP1 is a negative regulator of fibrosis progression in kidney and heart
25708842 Plasma ZAG was elevated in smokers, and correlated with male gender, smoking amount and duration, nicotine dependence, and metabolic syndrome.
25580089 we demonstrated a significant increase in ZAG in critically ill patients temporally related to recovery from sepsis
25561225 comprehensive evaluation of AZGP1 variation at the mRNA and protein level in colon cancer; study demonstrated that AZGP1 is a potential serum marker of colon cancer that may be correlated with tumorigenesis
25427682 Increased serum ZAG concentrations induced, at least partly, by Sp1 may cause an increase in vascular tone through the activation of RhoA
25076420 ZAG protein accumulates in plasma in ESRD and hemodialysis patients but this increase is not directly correlated to the decrease in GFR.
24918753 overexpression of AZGP1 suppressed the activation of the mTOR pathway and endogenous FASN-regulated fatty acid synthesis, mitigating the malignant phenotype of LoVo cells
24753506 ZAG plays an important role in modulating whole-body and adipose tissue insulin sensitivity. ZAG in subcutaneous, but not in visceral AT, was markedly reduced in obesity.
24508823 results show that AZGP-1, hCAP-D3, and E-cadherin are potentially useful immunohistochemical markers to predict BCR, and that AZGP-1 can be used as an independent prognostic marker of aggressive prostate cancer.
24465683 thyroid hormone up-regulates the production of zinc-alpha2-glycoprotein in the liver but not in the adipose tissue.
24374959 Both intracellular and extracellular localization of ZAG2 is identified in the brains of Krabbe's disease patients but not in control brains.
24188824 Zinc binding may be important for ZAG binding to fatty acids and the beta-adrenergic receptor.
24114735 AZGP1 and PIP were found in significantly lower levels in invasive breast tissue.
23935945 AZGP1 might serve as a candidate tumor suppressor and a potential prognostic biomarker in gastric carcinogenesis.
23849457 Circulating AZGP1 is elevated in chronic hemodialysis patients and sharply increases during the early phase of acute kidney injury.
23634719 High urine zinc alpha2-glycoprotein expression is associated with prostate cancer.
23448999 In cancer cachexia, ZAG release from white adipocytes is elevated and closely related to body weight loss. In cardiac cachexia, ZAG and circulating free fatty acids are closely related, suggesting a causative role in fat catabolism. [Review]
23423258 Overproduction of ZAG in white adipose tissue in chronic kidney disease could be a major contributor to metabolic disturbances associated with CKD.
23393224 Our data showed that the elevated AZGP1 and decreased PEDF and PRDX2 expressions in CRC serum and tissues were correlated with liver metastases. higher AZGP1 was also associated with a poorer disease-free survival.
23272038 cbZAG is lower in cord blood compared with maternal serum and correlates with gestational age at delivery, suggesting a role during the accelerated fetal growth during latter pregnancy
22935975 prostate ZAG staining correlated with a favorable outcome after prostatectomy for high-grade prostate cancer.
22739111 Reduced expression of AZGP1 led to a significant increase in the expression of lipogenic genes, thereby resulting in higher lipid levels.
22625427 HCC patients with high AZGP1 expression survived longer, with better overall survival and disease-free survival. In addition, low AZGP1 expression associated with worse relapse-free survival (P = 0.046) and distant metastatic progression-free survival
22498882 Urinary PGDS, not ZA2G, may serve as a biomarker for active LN and upon validation in larger studies, may become the non-invasive test to evaluate the disease activity in future management of LN.
22442679 ZAG could be involved in modulating lipid metabolism in adipose tissue and is associated with insulin resistance.
22425975 The genotypes of rs4215 in ZAG gene are significantly associated with obesity in Chinese north Han population. GG genotype subjects in rs4215 site have an increased susceptibility to obesity when compared with the AA+AG genotype subjects.
21791968 High serum Zn-alpha-2-glycoprotein is associated with preeclampsia.
21790656 These results indicate that ZAG, which is present on the human sperm membrane, plays a critical role in the acrosome reaction and subsequently, may be involved in sperm fertility.
21457004 The adipokine zinc-alpha2-glycoprotein activates AMP kinase in human primary skeletal muscle cells.
21443201 AZGP1 identified as a biomarker candidate for chronic pancreatitis.
21432866 AZGP1 is a potential molecular marker for biochemical relapse in men with margin-positive, localized PC.
21245862 ZAG may contribute to adipose atrophy associated with cancer cachexia in human beings.
20683033 REsults suggest both a relationship between ZAG expression and pathways involving adipokines or estrogen and that ZAG may be a potential breast cancer biomarker.
20661134 results indicate ZAG as a possible predictive marker of Gleason grade. The inverse association between grade and tissue expression with a rising serum protein level is similar to that seen with prostate-specific antigen. In addition, the results for both ZAG and PSMB-6 highlight the challenges in trying to associate the protein levels in serum with tissue expression
20595026 Macrophage-associated inflammation may play a significant role in the downregulation of ZAG in adipose tissue in obesity.
20581862 PCR array analysis revealed that AZGP1-induced epithelial transdifferentiation was accompanied by a series of concerted cellular events including a shift in the energy metabolism and prosurvival signals
20070991 Zn-alpha2-glycoprotein genotype and serum levels are associated with serum lipids.
20070991 Observational study of gene-disease association. (HuGE Navigator)
19934249 Treatment with TNFalpha reduced Zag gene expression in differentiated adipocytes.
19846741 The present study provides evidence of a role of ZAG gene in adipose tissue metabolism
19622624 Down-regulation of ZAG in in adipose tissue and liver exists in obese patients but is not related to insulin resistance.
19549246 expression in adipose tissue downregulated with increased adiposity and circulating insulin
19351730 ZAG might be involved in the pathogenesis of obesity-related metabolic disorders.
19188554 In the context that AZGP1 is involved in lipolysis and fat loss, its overexpression in the airway epithelium of chronic smokers may represent one mechanism for the weight difference in smokers vs. nonsmokers.
18978557 Overexpression of AZGP1 is associated with lung adenocarcinoma.
18930737 analysis of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18663996 this novel adipokine could play a role in human susceptibility to obesity related disorders
18567794 A review of the major aspects of ZAG from its gene structure to function and metabolism.
17724461 Elevated mRNA levels of AZGP1 is associated with lung adenocarcinoma
16598739 This study characterized ZAG protein (AZGP1) expression in prostate cancer using a semi-automated system. ZAG expression level found to have an independent prognostic value for pT2 patients.
16475792 Arg-73 projects into one end of the binding groove and is the sole charged amino acid adjacent to the ligand. Replacing this amino acid with alanine abolished ligand binding and closed the groove to solvent.
15620688 Human adipocytes express and secrete ZAG, with ZAG expression being regulated particularly through TNF-alpha and the PPARgamma nuclear receptor.
15477100 x-ray crystallographic analysis of ligand binding by Zn-alpha2-glycoprotein
14983038 ZAG gene expression and protein were detected in human adipose tissue.

AA Sequence

MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQP      1 - 70
MGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYD     71 - 140
GKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVV    141 - 210
VTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSC    211 - 280
HVQHSSLAQPLVVPWEAS                                                        281 - 298
//

Text Mined References (100)

PMID Year Title
26487699 2016 Zinc-induced oligomerization of zinc ?2 glycoprotein reveals multiple fatty acid-binding sites.
26383228 2016 Reduced AZGP1 expression is an independent predictor of early PSA recurrence and associated with ERG-fusion positive and PTEN deleted prostate cancers.
26068931 2015 Zinc-?2-Glycoprotein Modulates AKT-Dependent Insulin Signaling in Human Adipocytes by Activation of the PP2A Phosphatase.
25788525 2015 Zinc-?2-Glycoprotein Exerts Antifibrotic Effects in Kidney and Heart.
25708842 2015 Plasma zinc ?2-glycoprotein levels are elevated in smokers and correlated with metabolic syndrome.
25580089 2014 Circulating anti-inflammatory adipokines High Molecular Weight Adiponectin and Zinc-?2-glycoprotein (ZAG) are inhibited in early sepsis, but increase with clinical recovery: a pilot study.
25561225 2014 Zinc-?-2-glycoprotein: a candidate biomarker for colon cancer diagnosis in Chinese population.
25427682 2015 Significance of serum Zn-?2-glycoprotein for the regulation of blood pressure.
25076420 2014 The relationship between renal function and plasma concentration of the cachectic factor zinc-alpha2-glycoprotein (ZAG) in adult patients with chronic kidney disease.
24918753 2014 Alpha-2-glycoprotein 1(AZGP1) regulates biological behaviors of LoVo cells by down-regulating mTOR signaling pathway and endogenous fatty acid synthesis.
24753506 2014 Subcutaneous adipose tissue zinc-?2-glycoprotein is associated with adipose tissue and whole-body insulin sensitivity.
24508823 2014 AZGP-1 immunohistochemical marker in prostate cancer: potential predictive marker of biochemical recurrence in post radical prostatectomy specimens.
24465683 2014 Thyroid hormone upregulates zinc-?2-glycoprotein production in the liver but not in adipose tissue.
24374959 2013 Crosstalk in human brain between globoid cell leucodystrophy and zinc-?-2-glycoprotein (ZAG), a biomarker of lipid catabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
24188824 2013 Strong and weak zinc binding sites in human zinc-?2-glycoprotein.
24114735 2014 Additive effect of the AZGP1, PIP, S100A8 and UBE2C molecular biomarkers improves outcome prediction in breast carcinoma.
23935945 2013 Decreased expression of AZGP1 is associated with poor prognosis in primary gastric cancer.
23849457 2013 Zinc-alpha2-glycoprotein in patients with acute and chronic kidney disease.
23634719 2013 Development of an online microbore hollow fiber enzyme reactor coupled with nanoflow liquid chromatography-tandem mass spectrometry for global proteomics.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23448999 2013 Zinc-?2-glycoprotein as a marker of fat catabolism in humans.
23423258 2013 White adipose tissue overproduces the lipid-mobilizing factor zinc ?2-glycoprotein in chronic kidney disease.
23393224 2013 Prognostic role of serum AZGP1, PEDF and PRDX2 in colorectal cancer patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23272038 2012 Zinc-?2-glycoprotein is unrelated to gestational diabetes: anthropometric and metabolic determinants in pregnant women and their offspring.
22935975 2012 Utility of RhoC and ZAG protein expression as biomarkers for prediction of PSA failure following radical prostatectomy for high grade prostate cancer.
22739111 2012 Downregulation of fetuin-B and zinc-?2-glycoprotein is linked to impaired fatty acid metabolism in liver cells.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22625427 2012 Decreased expression of zinc-alpha2-glycoprotein in hepatocellular carcinoma associates with poor prognosis.
22498882 2012 Urinary proteomics revealed prostaglandin H(2)D-isomerase, not Zn-?2-glycoprotein, as a biomarker for active lupus nephritis.
22442679 2012 Zinc-alpha 2-glycoprotein gene expression in adipose tissue is related with insulin resistance and lipolytic genes in morbidly obese patients.
22425975 2012 rs4215 SNP in zinc-?2-glycoprotein gene is associated with obesity in Chinese north Han population.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21791968 2012 Serum levels of the adipokine zinc-?2-glycoprotein are increased in preeclampsia.
21790656 2012 Con A-binding protein Zn-?2-glycoprotein on human sperm membrane is related to acrosome reaction and sperm fertility.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21457004 2011 The adipokine zinc-?2-glycoprotein activates AMP kinase in human primary skeletal muscle cells.
21443201 2011 Protein alterations associated with pancreatic cancer and chronic pancreatitis found in human plasma using global quantitative proteomics profiling.
21432866 2011 Low AZGP1 expression predicts for recurrence in margin-positive, localized prostate cancer.
21245862 2011 Enhanced ZAG production by subcutaneous adipose tissue is linked to weight loss in gastrointestinal cancer patients.
20683033 2010 Zinc-alpha2-glycoprotein: a new biomarker of breast cancer?
20661134 2010 Evaluation of Zinc-?-2-Glycoprotein and Proteasome Subunit ?-Type 6 Expression in Prostate Cancer Using Tissue Microarray Technology.
20595026 2010 Macrophage-secreted factors inhibit ZAG expression and secretion by human adipocytes.
20581862 2010 AZGP1 is a tumor suppressor in pancreatic cancer inducing mesenchymal-to-epithelial transdifferentiation by inhibiting TGF-?-mediated ERK signaling.
20070991 2010 Preliminary report: Zn-alpha2-glycoprotein genotype and serum levels are associated with serum lipids.
19934249 2010 Downregulation of zinc-{alpha}2-glycoprotein in adipose tissue and liver of obese ob/ob mice and by tumour necrosis factor-alpha in adipocytes.
19846741 2009 Circulating and adipose tissue gene expression of zinc-alpha2-glycoprotein in obesity: its relationship with adipokine and lipolytic gene markers in subcutaneous and visceral fat.
19622624 2009 Lower zinc-alpha2-glycoprotein production by adipose tissue and liver in obese patients unrelated to insulin resistance.
19549246 2010 The adipokine zinc-alpha2-glycoprotein (ZAG) is downregulated with fat mass expansion in obesity.
19351730 2009 Serum zinc-alpha2-glycoprotein correlates with adiposity, triglycerides, and the key components of the metabolic syndrome in Chinese subjects.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19188554 2009 Cigarette smoking induces overexpression of a fat-depleting gene AZGP1 in the human.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18978557 2008 AZGP1 autoantibody predicts survival and histone deacetylase inhibitors increase expression in lung adenocarcinoma.
18930737 2008 Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18663996 2008 ZAG, a lipid mobilizing adipokine, is downregulated in human obesity.
18567794 2008 Zinc alpha 2-glycoprotein: a multidisciplinary protein.
17724461 2008 AZGP1 mRNA levels in normal human lung tissue correlate with lung cancer disease status.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16598739 2006 Characterization of ZAG protein expression in prostate cancer using a semi-automated microscope system.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16475792 2006 Zn-alpha2-glycoprotein, an MHC class I-related glycoprotein regulator of adipose tissues: modification or abrogation of ligand binding by site-directed mutagenesis.
16341674 2005 Transcriptome analysis of human gastric cancer.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
15620688 2005 Zinc-alpha2-glycoprotein, a lipid mobilizing factor, is expressed and secreted by human (SGBS) adipocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15477100 2004 Crystallographic studies of ligand binding by Zn-alpha2-glycoprotein.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15084671 2004 A proteomic analysis of human bile.
14983038 2004 Zinc-alpha2-glycoprotein, a lipid mobilizing factor, is expressed in adipocytes and is up-regulated in mice with cancer cachexia.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
13689030 1961 Preparation and properties of Zn-alpha 2-glycoprotein of normal human plasma.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11425849 2001 Hydrophobic ligand binding by Zn-alpha 2-glycoprotein, a soluble fat-depleting factor related to major histocompatibility complex proteins.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10594376 1999 Peptide mapping of proteins in cerebrospinal fluid utilizing a rapid preparative two-dimensional electrophoretic procedure and matrix-assisted laser desorption/ionization mass spectrometry.
10462714 1999 Characterization of zinc-alpha(2)-glycoprotein as a cell adhesion molecule that inhibits the proliferation of an oral tumor cell line.
10206894 1999 Crystal structure of human ZAG, a fat-depleting factor related to MHC molecules.
9813179 1998 Regulation of Zn-alpha2-glycoprotein-mediated cell adhesion by kininogens and their derivatives.
9328826 1997 Detection and cloning of epidermal zinc-alpha 2-glycoprotein cDNA and expression in normal human skin and in tumors.
9239523 Gene expression of zinc-alpha 2-glycoprotein in normal human epidermal and buccal epithelia.
9114041 1997 Biochemical characterization and crystalization of human Zn-alpha2-glycoprotein, a soluble class I major histocompatibility complex homolog.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8307568 1993 Human Zn-alpha 2-glycoprotein: complete genomic sequence, identification of a related pseudogene and relationship to class I major histocompatibility complex genes.
8241150 1993 Molecular cloning and chromosomal assignment of the gene for human Zn-alpha 2-glycoprotein.
6896906 1982 Nephritogenic glycoprotein. IX. Plasma Zn-alpha2-glycoprotein as a second source of nephritogenic glycoprotein in urine.
3422450 1988 Complete amino acid sequence of human plasma Zn-alpha 2-glycoprotein and its homology to histocompatibility antigens.
2049092 1991 Cloning and nucleotide sequence of a human Zn-alpha 2-glycoprotein cDNA and chromosomal assignment of its gene.
1918940 1991 Immunohistochemical localization of Zn-alpha 2-glycoprotein in normal human tissues.
1915885 1991 Human Zn-alpha 2-glycoprotein cDNA cloning and expression analysis in benign and malignant breast tissues.