Property Summary

Ligand Count 42
NCBI Gene PubMed Count 218
PubMed Score 528.13
PubTator Score 521.37

Knowledge Summary

Patent (74,117)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Kallmann syndrome 33 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 4.995 2.5
Disease Target Count Z-score Confidence
Myopia 176 3.856 1.9
Astigmatism 54 3.057 1.5

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -2.682 7.4e-07
astrocytoma 2.100 3.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.226 7.3e-03
Becker muscular dystrophy 1.261 7.1e-04
Breast cancer -1.100 6.6e-05
chronic kidney disease 1.300 3.4e-02
colon cancer -1.800 2.7e-04
Down syndrome 1.100 2.6e-03
Duchenne muscular dystrophy 1.317 6.7e-08
gastric carcinoma 1.100 3.0e-02
glioblastoma 1.600 2.6e-02
group 3 medulloblastoma -1.300 1.5e-03
intraductal papillary-mucinous adenoma (... -2.000 4.0e-03
intraductal papillary-mucinous carcinoma... -2.000 1.2e-02
lung cancer -1.300 1.5e-02
lung carcinoma -1.400 1.3e-19
malignant mesothelioma 1.500 8.4e-07
medulloblastoma, large-cell -3.200 5.5e-08
non-small cell lung cancer -1.051 1.3e-10
ovarian cancer -2.300 4.9e-07
pancreatic cancer 2.000 5.0e-03
primary pancreatic ductal adenocarcinoma 2.072 2.3e-03
psoriasis -1.100 7.4e-03
tuberculosis -1.700 7.1e-05
ulcerative colitis 1.600 3.1e-04

Gene RIF (193)

AA Sequence

MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWL      1 - 70
RDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY     71 - 140
FLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNA    141 - 210
KGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSNDGMGIQAGEPDPPE    211 - 280
EPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAF    281 - 350
VHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP    351 - 420
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVE    421 - 490
RGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDS    491 - 560
ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHS    561 - 630
FLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG    631 - 700
DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQ    701 - 770
PADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA    771 - 840
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA                    841 - 894
//

Text Mined References (227)

PMID Year Title