Property Summary

Ligand Count 4
NCBI Gene PubMed Count 106
PubMed Score 241.49
PubTator Score 149.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count
Tooth agenesis 44
Carcinoma of colon 32

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.8e-02
breast carcinoma -1.300 4.9e-06
ependymoma 2.200 4.8e-02
interstitial cystitis -1.500 1.0e-03
invasive ductal carcinoma -1.800 1.5e-02
lung adenocarcinoma -1.900 3.4e-08
osteosarcoma 1.232 4.0e-02
ovarian cancer -2.300 3.3e-06
subependymal giant cell astrocytoma -1.455 1.1e-02
tuberculosis and treatment for 6 months 1.100 2.1e-03

Protein-protein Interaction (6)

Gene RIF (89)

AA Sequence

MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNEDGLGEPEGRAS      1 - 70
PDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIE     71 - 140
NNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYM    141 - 210
SNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPV    211 - 280
NPYHIGSGYVFAPATSANDSEISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLP    281 - 350
HFPRTHRLPKEMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ    351 - 420
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPA    421 - 490
AASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSK    491 - 560
APETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLESERQS    561 - 630
KPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEA    631 - 700
CRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFF    701 - 770
CGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE    771 - 840
RID                                                                       841 - 843
//

Text Mined References (107)

PMID Year Title