Property Summary

NCBI Gene PubMed Count 163
PubMed Score 280.40
PubTator Score 217.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Liver carcinoma 217
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.5e-05
psoriasis 6685 2.3e-05
osteosarcoma 7933 1.8e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Liver cancer 31 0.0 1.0
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Parkinson's disease 364 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.743 2.4
Disease Target Count Z-score Confidence
Familial adenomatous polyposis 33 3.622 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.300 2.3e-05
osteosarcoma 1.295 1.8e-04
atypical teratoid / rhabdoid tumor 1.100 1.5e-05

Gene RIF (90)

PMID Text
27138857 The pool of ADP-ribosylated Axin, which is degraded under basal conditions, increases immediately following Wnt stimulation in both Drosophila and human cells.
26974125 Cancer point mutations in the scaffold protein Axin derail Wnt signaling and promote tumor growth in vivo through a gain-of-function mechanism.
26393419 GSK3 acts through APC motifs R2 and B to regulate APC:Axin interactions, promoting high-throughput of betacatenin to destruction.
26214021 Data show that 5-hydroxytryptamine receptor (5-HT1DR) played an important role in cell invasion via Axin1/beta-catenin/matrix metalloproteinase 7 (MMP-7) pathway.
25802106 We have offered primary evidence that the T allele and T/T genotype of rs370681 polymorphisms and C/T genotype of rs1805105 polymorphisms in AXIN1 gene are more frequent in patients with cryptorchidism.
25735981 suggest a novel mechanism of Wnt signaling through the dissociation of the beta-catenin destruction complex by Axin1 Thr160 modification
25355064 Significantly increased atrial septal defect risk was observed to be associated with the A allele of rs12921862
24846767 Higher expression of AXIN1 protein in IUGR placentae indicates a role of Wnt/beta-catenin signaling pathway in pathology of placental development.
24722208 In adenomatous polyposis coli, beta-catenin phosphorylation involves Axin and the 20 amino acids of APC or APCL.
24419084 Which destabilize beta-catenin through stabilizing Axin.
24011952 Gastric neoplasia of chief cell-predominant type (GN-CCP) as a unique variant of nonaggressive tumor are characterized by nuclear beta-catenin accumulation and mutation of CTNNB1 or AXIN gene, suggesting activation of the Wnt/beta-catenin pathway.
23915259 methylation status of the Axin gene may be one important factor to predict radiosensitivity of lung cancer.
23879168 Our study revealed that alterations of AXIN1 were involved in hepatitis B virus-related hepatocellular carcinoma
23525311 The expression levels of CTNNB1, AXIN1 and APC did not correlate with the beta-catenin mutation status, which corroborates previous gene expression micro-array analyses
23278310 In invasive breast cancer preserved Axin expression is associated with a more aggressive phenotype and reduced survival.
23277359 HectD1 promotes the APC-Axin interaction to negatively regulate Wnt signaling.
23192643 Abnormal hypermethylation of Axin gene is associated with lung cancer.
23135750 This study study showed that HMGA2 was able to elicit EMT and regulate several genes which are closely related to the Wnt/beta-catenin pathway by directly binding to their promoter.
23110995 X-radiation and siRNA inhibit expression of HDAC1 and HDAC2, weaken the inhibitory effect of HDAC on Axin, upregulate Axin expression and induce apoptosis of lung cancer cells
22933777 Phosphorylation of axin-1 by glycogen synthase kinase(GSK)-3beta accelerates the association of axin-1 with beta-catenin.
22682247 Results demonstrate that beta-catenin is not only phosphorylated inside the APC/Axin1 destruction complex, but also ubiquinated and degraded via the proteasome, all within an intact Axin1 complex.
22614067 respiratory epithelial polygonal and cuboidal cells have distinct expression of beta-catenin, Axin, and C-myc
22524844 Low axin1 is associated with hepatocellular carcinoma.
22234612 Wnt/beta-catenin signaling and AXIN1 may regulate the efficacy of inhibitors of BRAF(V600E), suggesting that manipulation of the Wnt/beta-catenin pathway could be combined with BRAF inhibitors to treat melanoma
21902576 3 synonymous alterations (p.P39P, p.D260D, p.V383V)were found in patients with ALL and one novel synonymous alteration (p.G67G) in the cohort with AML. A new g.G42525A variation was seen in intron 4-5 in 3 patients with acute leukemia.
21808024 These results reveal an important mode of Myc activation in human breast cancer and a mechanism contributing to Myc deregulation involving unique insight into inactivation of the Axin1 tumor suppressor in breast cancer.
21799911 RNF146 RING-type ubiquitin E3 ligase as a positive regulator of Wnt signaling that operates with tankyrase to maintain low steady-state levels of Axin proteins
21769465 Despite the absence of AXIN1 gene mutations, the low level of Axin-1 protein in the cytoplasm probably also plays a role in tumorigenesis.
21648318 Axin I expression was investigated in 42 patients with glioblastoma, the most aggressive form of glial tumors. Immunostaining and image analysis revealed the quantity and localization of the protein.
21383061 axin associates with ubiquitin-specific protease 34 (USP34); results indicate USP34 controls the levels of axin and positively modulate Wnt signaling by acting downstream of beta-catenin stabilization through controlling the nuclear accumulation of axin
21242974 methylation of Axin by PRMT1 may serve as a finely tuned regulation mechanism for Wnt/beta-catenin signaling.
21087614 these results support a model in which the unfolded nature of these critical scaffolding regions in Axin1 facilitates dynamic interactions with a kinase and its substrate, which in turn act upon each other.
21057547 found that dominant-negative mutants of PML blocked AXIN-induced p53 activation, and that AXIN promotes PML sumoylation, a modification necessary for PML functions
20846493 Study demonstrate that the DIX domains of Dvl and Axin are expressed noticeably in a multi-cistronic system but not in a mono-cistronic system.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20128690 MAP3K1 functionally interacts with Axin1 in the canonical Wnt signalling pathway
20122174 Axin downregulates TCF-4 transcription via beta-catenin and independently of p53.
20098615 A haplotype within the AXIN1-PDIA2 locus (p-value of 2.926x10(-06)) and a haplotype within the Endoglin gene (p-value of 5.881x10(-04)) were found to be strongly associated with bicuspid aortic valve
20098615 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19778269 These results suggest that Axin1 plays a negative role in HIV-1 transcription through the Wnt signaling pathway in J111 cells under normal cell culture conditions.
19778269 Axin1 regulates HIV-1 Tat-mediated transcription, which requires beta-catenin and TCF4
19731416 Axin is a critical determinant in p53-dependent tumour suppression in which Pirh2 and Tip60 have different roles in triggering cell-cycle arrest or apoptosis depending on the severity of genotoxic stress.
19633924 Down regulation of axin expression and up regulation of beta-catenin were detected in neuroepithelial brain tumors
19582507 Reduced axin protein expression is associated with squamous cell carcinoma of esophagus.
19513548 Axin induces cell death and reduces cell proliferation in astrocytoma by activating the p53 pathway.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19390532 Axin, but not Axin2, is involved in microtubule nucleation by forming a complex with gamma-tubulin at the centrosome.
19331826 Results suggest that Axin modulates distribution of Axin-associated proteins in an expression level-dependent manner and these interactions affect the mitotic process.
19141611 Zbed3 is a novel Axin-binding protein that is involved in Wnt/beta-catenin signaling modulation.
19131971 A novel role for the tumour suppressor scaffold protein Axin1 in facilitating the formation of a degradation complex for c-Myc containing GSK3beta, Pin1, and PP2A-B56alpha is reported.
18708403 Observational study of gene-disease association. (HuGE Navigator)
18632848 the C6 motif seems to reduce the interaction of Axin with Dvl-1.
18514389 Wnt dysregulation plays a role in prostatic tumourigenesis. Of particular interest, we identified three new potentially functionally relevant AXIN1 mutations
18330950 Mutations in AXIN1 and AXIN2 may contribute to gastric carcinogenesis.
18171349 activation of Wnt signaling through AXIN1 rather than beta-catenin mutation might play an important role in liver carcinogenesis.
17768662 Reduced expression of axin is associated with the development of lung cancer
17720811 The activation of p38 was dependent on Axin and was required for the enhancement of mesenchymal stem cells differentiation by Wnt-4.
17560945 Knockdown of axin1 by siRNAs significantly enhances HIV-1 replication in human acute monocytic leukemia cells
17418091 The retained beta-catenin in cytoplasm by APC may be down-regulated by Axin 2, which is induced by beta-catenin/Tcf signaling.
17143297 AXIN1, AXIN2 and TCF7L2 may have roles in development of colorectal carcinomas [review]
17018282 Data show that P68 RNA helicase mediates platelet-derived growth factor-induced epithelial mesenchymal transition by displacing Axin from beta-catenin.
16868183 These findings establish that the RGS domain of axin is able to directly interact with the alpha subunit of heterotrimeric G protein G12 and provide a unique tool to interdict Galpha12-mediated signaling processes.
16773576 findings raise the possibility that hypermethylation of the AXIN1 promoter, by mechanisms as yet undetermined, is associated with caudal duplication
16772034 Splice forms of crucial genes of the Wnt-pathway, beta-Catenin, LRP5, GSK3beta, Axin-1 and CtBP1 are expressed in human colorectal tissue.
16601693 Axin and Arkadia cooperate with each other in promoting Smad7 ubiquitination.
16163548 Axin1 gene may be one of the mutational target in oral SCC.
15981102 No significant genetic alterations were found.
15698401 Beta-catenin stabilization because of either beta-catenin or AXIN I mutation might be a late event for malignant progression rather than an early genetic event involving the initiation of HCC development.
15579909 Axin forms homodimeric interactions through three domains, D, I, and DIX
15526030 Axin acts as a tumor suppressor by facilitating p53 function
15520370 Observational study of gene-disease association. (HuGE Navigator)
15355978 APC is down-regulated by the ubiquitin-proteasome pathway in a process facilitated by Axin
15262978 Ccd1 drastically inhibited JNK activation both by Axin and by Dvl.
15064706 In the presence of p53, the movement of Axin into & out of the Triton X-100-insoluble fraction is accelerated. p53 induces a faster mobilization of Axin into the degradation complex
15063782 We also found that cyclin A/CDK2 phosphorylates Axin, thereby enhancing its association with beta-catenin.
14970870 neither AXIN1 gene mutations nor AXIN1 locus LOH are involved in Wnt pathway activation in gastroesophageal junction adenocarcinomas
14630927 Axin binds directly to the export factor CRM1 in the presence of RanGTP
14566817 The missense mutation rate is 11%, suggesting that Axin deficiency may contribute to the onset of colorectal tumorigenesis.
14534723 a tumor-associated mutation of the Axin gene is generally a rare event in pediatric neoplasms
12883680 mutations of AXIN1 may play a limited role in tumorigenesis of cervical cancer
12771989 Reduced expression of Axin correlates with tumour progression of esophageal squamous cell carcinoma
12717450 In mice, ectopic expression of Axin1, an inhibitor of the Wnt signalling pathway, restricts haematopoietic stem cell (HSC) growth in vitro and reduces reconstitution in vivo.
12555076 identification of mutations but not deletions in cerebellar medulloblastomas
12554650 Data report the crystal structure of glycogen synthase kinase 3beta (GSK3beta) in complex with a minimal GSK3beta-binding segment of axin, at 2.4 A resolution.
12209999 Role of Wnt pathway in medulloblastoma oncogenesis: accumulation of beta-catenin in tumor cells was immunohistochemically proven in 5 cases; 2 cases showed positive immunoreactivity for Wnt-1 and another 2 showed mutation of either CTNNB1 or AXIN1
12036951 Overexpression of Icat induces G(2) arrest and cell death in tumor cell mutants for adenomatous polyposis coli, beta-catenin, or Axin.
12000790 Axin-mediated CKI phosphorylation of beta-catenin at Ser 45: a molecular switch for the Wnt pathway.

AA Sequence

MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGY      1 - 70
EPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKL     71 - 140
ARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEY    141 - 210
TRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRV    211 - 280
SSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRK    281 - 350
QHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE    351 - 420
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPG    421 - 490
HRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQS    491 - 560
SFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQ    561 - 630
KIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPA    631 - 700
PNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQR    701 - 770
KVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV    771 - 840
REDEAVLPVFEEKIIGKVEKVD                                                    841 - 862
//

Text Mined References (167)

PMID Year Title
27138857 2016 Wnt pathway activation by ADP-ribosylation.
27098453 2016 WDR26 is a new partner of Axin1 in the canonical Wnt signaling pathway.
26974125 2016 Axin cancer mutants form nanoaggregates to rewire the Wnt signaling network.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26393419 2015 A novel GSK3-regulated APC:Axin interaction regulates Wnt signaling by driving a catalytic cycle of efficient ?catenin destruction.
26214021 2015 5-hydroxytryptamine receptor (5-HT1DR) promotes colorectal cancer metastasis by regulating Axin1/?-catenin/MMP-7 signaling pathway.
25873176 2015 TGIF governs a feed-forward network that empowers Wnt signaling to drive mammary tumorigenesis.
25802106 2015 The variations in the AXIN1 gene and susceptibility to cryptorchidism.
25735981 2015 Thr160 of Axin1 is critical for the formation and function of the ?-catenin destruction complex.
25355064 2014 Association between polymorphisms in AXIN1 gene and atrial septal defect.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25236910 2014 AXIN1 and AXIN2 variants in gastrointestinal cancers.
24976009 2014 YAP/TAZ incorporation in the ?-catenin destruction complex orchestrates the Wnt response.
24846767 2015 Glycosylation pattern and axin expression in normal and IUGR placentae.
24722208 2014 different Roles for the axin interactions with the SAMP versus the second twenty amino acid repeat of adenomatous polyposis coli.
24419084 2014 LEF1 and B9L shield ?-catenin from inactivation by Axin, desensitizing colorectal cancer cells to tankyrase inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24011952 2013 Alteration in the Wnt/?-catenin signaling pathway in gastric neoplasias of fundic gland (chief cell predominant) type.
23996749 2013 [AXIN1-related CSRNP1 mRNA expression and its transcriptional regulation in TGF-?1-induced tumor cells].
23915259 2013 Axin gene methylation status correlates with radiosensitivity of lung cancer cells.
23879168 2013 Alterations of axis inhibition protein 1 (AXIN1) in hepatitis B virus-related hepatocellular carcinoma and overexpression of AXIN1 induces apoptosis in hepatocellular cancer cells.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23525311 2013 CTNNB1, AXIN1 and APC expression analysis of different medulloblastoma variants.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23278310 2013 Preserved Axin expression is associated with an aggressive phenotype in invasive breast carcinomas.
23277359 2013 HectD1 E3 ligase modifies adenomatous polyposis coli (APC) with polyubiquitin to promote the APC-axin interaction.
23192643 2013 Abnormal hypermethylation and clinicopathological significance of Axin gene in lung cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23135750 2013 HMGA2 elicits EMT by activating the Wnt/?-catenin pathway in gastric cancer.
23110995 2012 X-radiation inhibits histone deacetylase 1 and 2, upregulates Axin expression and induces apoptosis in non-small cell lung cancer.
22933777 2012 GSK3?/axin-1/?-catenin complex is involved in semaphorin3A signaling.
22899650 2012 LRRK2 functions as a Wnt signaling scaffold, bridging cytosolic proteins and membrane-localized LRP6.
22773187 2012 Dual functions of DP1 promote biphasic Wnt-on and Wnt-off states during anteroposterior neural patterning.
22682247 2012 Wnt signaling through inhibition of ?-catenin degradation in an intact Axin1 complex.
22614067 2012 In pulmonary sclerosing hemangioma expression of ?-catenin, Axin, and C-myc differs between the two cell types.
22524844 2012 Clinical significance of axin and ?-catenin protein expression in primary hepatocellular carcinomas.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22234612 2012 Wnt/?-catenin signaling and AXIN1 regulate apoptosis triggered by inhibition of the mutant kinase BRAFV600E in human melanoma.
22153077 2011 Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21902576 2012 Genetic alterations in members of the Wnt pathway in acute leukemia.
21808024 2012 Mechanistic insight into Myc stabilization in breast cancer involving aberrant Axin1 expression.
21799911 2011 Ubiquitin ligase RNF146 regulates tankyrase and Axin to promote Wnt signaling.
21769465 2012 Clinicopathological analysis of ?-catenin and Axin-1 in solid pseudopapillary neoplasms of the pancreas.
21648318 2011 AXIN-1 protein expression and localization in glioblastoma.
21478859 2011 RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.
21383061 2011 The ubiquitin-specific protease USP34 regulates axin stability and Wnt/?-catenin signaling.
21242974 2011 Methylation by protein arginine methyltransferase 1 increases stability of Axin, a negative regulator of Wnt signaling.
21087614 2011 Critical scaffolding regions of the tumor suppressor Axin1 are natively unfolded.
21057547 2011 AXIN is an essential co-activator for the promyelocytic leukemia protein in p53 activation.
20846493 2010 Coexpression and protein-protein complexing of DIX domains of human Dvl1 and Axin1 protein.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20128690 MAP3K1 functionally interacts with Axin1 in the canonical Wnt signalling pathway.
20122174 2010 Axin downregulates TCF-4 transcription via beta-catenin, but not p53, and inhibits the proliferation and invasion of lung cancer cells.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
20080667 2010 Role of DAB2IP in modulating epithelial-to-mesenchymal transition and prostate cancer metastasis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19778269 2009 Short communication: RNA interference directed against Axin1 upregulates human immunodeficiency virus type 1 gene expression by activating the Wnt signaling pathway in HeLa-derived J111 cells.
19759537 2009 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling.
19731416 2009 Axin determines cell fate by controlling the p53 activation threshold after DNA damage.
19633924 2010 Changes of AXIN-1 and beta-catenin in neuroepithelial brain tumors.
19582507 2009 Reduced axin protein expression is associated with a poor prognosis in patients with squamous cell carcinoma of esophagus.
19513548 2009 Axin induces cell death and reduces cell proliferation in astrocytoma by activating the p53 pathway.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19390532 2009 Axin localizes to the centrosome and is involved in microtubule nucleation.
19331826 2009 Axin localizes to mitotic spindles and centrosomes in mitotic cells.
19303846 2009 Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling.
19249679 2009 Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization.
19166851 2009 Kaiso is a bimodal modulator for Wnt/beta-catenin signaling.
19141611 2009 Identification of zinc-finger BED domain-containing 3 (Zbed3) as a novel Axin-interacting protein that activates Wnt/beta-catenin signaling.
19131971 2009 The Axin1 scaffold protein promotes formation of a degradation complex for c-Myc.
19038973 2009 Identification of WNT/beta-CATENIN signaling pathway components in human cumulus cells.
18786926 2008 Identification of a link between the SAMP repeats of adenomatous polyposis coli tumor suppressor and the Src homology 3 domain of DDEF.
18708403 2008 Association of genetic variation in genes implicated in the beta-catenin destruction complex with risk of breast cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632848 2008 SUMOylation target sites at the C terminus protect Axin from ubiquitination and confer protein stability.
18593713 2008 Smad7 stabilizes beta-catenin binding to E-cadherin complex and promotes cell-cell adhesion.
18514389 2009 Mutations in the AXIN1 gene in advanced prostate cancer.
18330950 2008 Mutations in components of the Wnt signaling pathway in gastric cancer.
18171349 2008 Genetic alterations of Wnt signaling pathway-associated genes in hepatocellular carcinoma.
17768662 2007 Overexpression of axin downregulates TCF-4 and inhibits the development of lung cancer.
17720811 2007 Noncanonical Wnt-4 signaling enhances bone regeneration of mesenchymal stem cells in craniofacial defects through activation of p38 MAPK.
17601533 2007 Two functionally distinct Axin-like proteins regulate canonical Wnt signaling in C. elegans.
17588722 2007 Htid-1, the human homolog of the Drosophila melanogaster l(2)tid tumor suppressor, defines a novel physiological role of APC.
17569865 2007 Wnt induces LRP6 signalosomes and promotes dishevelled-dependent LRP6 phosphorylation.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17418091 2007 Axin-independent phosphorylation of APC controls beta-catenin signaling via cytoplasmic retention of beta-catenin.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17318191 2007 Bcr-Abl stabilizes beta-catenin in chronic myeloid leukemia through its tyrosine phosphorylation.
17318175 2007 Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex.
17210684 2007 Daxx cooperates with the Axin/HIPK2/p53 complex to induce cell death.
17143297 2006 Colorectal cancer and genetic alterations in the Wnt pathway.
17018282 2006 P68 RNA helicase mediates PDGF-induced epithelial mesenchymal transition by displacing Axin from beta-catenin.
16890161 2006 Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin.
16868183 2006 The regulator of G protein signaling domain of axin selectively interacts with Galpha12 but not Galpha13.
16773576 2006 Increased DNA methylation at the AXIN1 gene in a monozygotic twin from a pair discordant for a caudal duplication anomaly.
16772034 2006 Verification of predicted alternatively spliced Wnt genes reveals two new splice variants (CTNNB1 and LRP5) and altered Axin-1 expression during tumour progression.
16753179 2006 The third 20 amino acid repeat is the tightest binding site of APC for beta-catenin.
16601693 2006 Axin is a scaffold protein in TGF-beta signaling that promotes degradation of Smad7 by Arkadia.
16293619 2006 Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity.
16188939 2005 The adenomatous polyposis coli protein (APC) exists in two distinct soluble complexes with different functions.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16163548 2005 Mutations of the APC, beta-catenin, and axin 1 genes and cytoplasmic accumulation of beta-catenin in oral squamous cell carcinoma.
15981102 2005 Infrequent mutation of APC, AXIN1, and GSK3B in human pituitary adenomas with abnormal accumulation of CTNNB1.
15698401 2005 Mutations of beta-catenin and AXIN I genes are a late event in human hepatocellular carcinogenesis.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15579909 2005 Axin contains three separable domains that confer intramolecular, homodimeric, and heterodimeric interactions involved in distinct functions.
15526030 2004 Axin stimulates p53 functions by activation of HIPK2 kinase through multimeric complex formation.
15520370 2004 Multiple rare variants in different genes account for multifactorial inherited susceptibility to colorectal adenomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355978 2004 Adenomatous polyposis coli is down-regulated by the ubiquitin-proteasome pathway in a process facilitated by Axin.
15327769 2004 Crystal structure of a beta-catenin/APC complex reveals a critical role for APC phosphorylation in APC function.
15262978 2004 The DIX domain protein coiled-coil-DIX1 inhibits c-Jun N-terminal kinase activation by Axin and dishevelled through distinct mechanisms.
15064706 2004 Downregulation of beta-catenin by p53 involves changes in the rate of beta-catenin phosphorylation and Axin dynamics.
15063782 2004 Cyclin-dependent kinase 2 regulates the interaction of Axin with beta-catenin.
14970870 2004 Frequent loss of the AXIN1 locus but absence of AXIN1 gene mutations in adenocarcinomas of the gastro-oesophageal junction with nuclear beta-catenin expression.
14630927 2004 Nucleo-cytoplasmic shuttling of Axin, a negative regulator of the Wnt-beta-catenin Pathway.
14566817 2003 Detection of point mutations of the Axin1 gene in colorectal cancers.
14534723 Detection of a novel alteration of the Axin gene in various pediatric neoplasms.
12897152 2003 A novel mechanism for Wnt activation of canonical signaling through the LRP6 receptor.
12883680 Mutation analysis of CTNNB1 (beta-catenin) and AXIN1, the components of Wnt pathway, in cervical carcinomas.
12820959 2003 Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity of the SCF(beta-TrCP1) ubiquitin ligase.
12805222 2003 Regulation of the Wnt signaling pathway by disabled-2 (Dab2).
12771989 2003 Reduced expression of Axin correlates with tumour progression of oesophageal squamous cell carcinoma.
12717450 2003 A role for Wnt signalling in self-renewal of haematopoietic stem cells.
12556519 2003 Casein kinase I epsilon enhances the binding of Dvl-1 to Frat-1 and is essential for Wnt-3a-induced accumulation of beta-catenin.
12555076 2003 AXIN1 mutations but not deletions in cerebellar medulloblastomas.
12554650 2003 Structural basis for recruitment of glycogen synthase kinase 3beta to the axin-APC scaffold complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223491 2002 SUMO-1 modification of the C-terminal KVEKVD of Axin is required for JNK activation but has no effect on Wnt signaling.
12209999 2002 Role of Wnt pathway in medulloblastoma oncogenesis.
12192039 2002 I-mfa domain proteins interact with Axin and affect its regulation of the Wnt and c-Jun N-terminal kinase signaling pathways.
12138115 2002 Frizzled-9 is activated by Wnt-2 and functions in Wnt/beta -catenin signaling.
12101426 2002 Mutational spectrum of beta-catenin, AXIN1, and AXIN2 in hepatocellular carcinomas and hepatoblastomas.
12072559 2002 Subcellular distribution of Wnt pathway proteins in normal and neoplastic colon.
12036951 2002 Overexpression of Icat induces G(2) arrest and cell death in tumor cell mutants for adenomatous polyposis coli, beta-catenin, or Axin.
12000790 2002 Axin-mediated CKI phosphorylation of beta-catenin at Ser 45: a molecular switch for the Wnt pathway.
11997515 2002 Desumoylation activity of Axam, a novel Axin-binding protein, is involved in downregulation of beta-catenin.
11955436 2002 Control of beta-catenin phosphorylation/degradation by a dual-kinase mechanism.
11884395 2002 Casein kinase I and casein kinase II differentially regulate axin function in Wnt and JNK pathways.
11809808 2002 Wnt/beta-catenin/Tcf signaling induces the transcription of Axin2, a negative regulator of the signaling pathway.
11738041 2001 The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation.
11719457 2001 Diverse mechanisms of beta-catenin deregulation in ovarian endometrioid adenocarcinomas.
11557983 2001 The SH2/SH3 adaptor Grb4 transduces B-ephrin reverse signals.
11487578 2001 Axin-dependent phosphorylation of the adenomatous polyposis coli protein mediated by casein kinase 1epsilon.
11438668 2001 Axin facilitates Smad3 activation in the transforming growth factor beta signaling pathway.
11336703 2001 Low-density lipoprotein receptor-related protein-5 binds to Axin and regulates the canonical Wnt signaling pathway.
11297546 2001 Inhibition of the Wnt signaling pathway by the PR61 subunit of protein phosphatase 2A.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10829020 2000 Dimerization choices control the ability of axin and dishevelled to activate c-Jun N-terminal kinase/stress-activated protein kinase.
10811618 2000 Structural basis of the Axin-adenomatous polyposis coli interaction.
10700176 2000 AXIN1 mutations in hepatocellular carcinomas, and growth suppression in cancer cells by virus-mediated transfer of AXIN1.
10698523 2000 GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
10581160 1999 A GSK3beta phosphorylation site in axin modulates interaction with beta-catenin and Tcf-mediated gene expression.
10488109 1999 Axin directly interacts with plakoglobin and regulates its stability.
10330403 1999 Domains of axin involved in protein-protein interactions, Wnt pathway inhibition, and intracellular localization.
10228155 1999 An F-box protein, FWD1, mediates ubiquitin-dependent proteolysis of beta-catenin.
9920888 1999 Identification of a domain of Axin that binds to the serine/threonine protein phosphatase 2A and a self-binding domain.
9734785 1998 Axin, an inhibitor of the Wnt signalling pathway, interacts with beta-catenin, GSK-3beta and APC and reduces the beta-catenin level.
9601641 1998 Downregulation of beta-catenin by human Axin and its association with the APC tumor suppressor, beta-catenin and GSK3 beta.
9482734 1998 Axin, a negative regulator of the Wnt signaling pathway, forms a complex with GSK-3beta and beta-catenin and promotes GSK-3beta-dependent phosphorylation of beta-catenin.
9335612 1997 Two dominant mutations in the mouse fused gene are the result of transposon insertions.
9230313 1997 The mouse Fused locus encodes Axin, an inhibitor of the Wnt signaling pathway that regulates embryonic axis formation.
9054936 1997 The relationship between chromosome structure and function at a human telomeric region.