Property Summary

Ligand Count 316
NCBI Gene PubMed Count 133
PubMed Score 1978.59
PubTator Score 427.33

Knowledge Summary

Patent (5,813)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Protein-protein Interaction (1)

Gene RIF (87)

AA Sequence

MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGH      1 - 70
WAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRA     71 - 140
ICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIA    141 - 210
LMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVY    211 - 280
VLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPS    281 - 350
LGPQDESCTTASSSLAKDTSS                                                     351 - 371
//

Text Mined References (136)

PMID Year Title