Property Summary

NCBI Gene PubMed Count 75
PubMed Score 202.04
PubTator Score 155.57

Knowledge Summary

Patent (3,152)

Expression

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
2797 screening 815 / 0 / 324043 Counterscreen for Oxytocin Receptor (OXTR) agonists: Fluorescence-based primary cell-based high throughput assay to identify agonists of the vasopressin 1 receptor (V1R)
434964 screening 29 / 0 / 146 Fluorescence-based cell-based high throughput confirmation assay for agonists of the vasopressin 1 receptor (V1R)
434991 screening 47 / 0 / 339 Counterscreen for Oxytocin Receptor (OXTR) agonists: Fluorescence-based cell-based high throughput screening assay to identify agonists of the vasopressin 1 receptor (V1R), in triplicate
463108 confirmatory 2 / 0 / 20 Counterscreen for Oxytocin Receptor (OXTR) agonists: Fluorescence-based cell-based high throughput dose response assay to identify agonists of the vasopressin 1 receptor (V1R)
463127 confirmatory 7 / 0 / 5 Fluorescence-based cell-based high throughput dose response screening assay for agonists of the vasopressin 1 receptor (V1R)
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (66)

PMID Text
26295806 Higher acute vulnerability to stress exists in persons with long AVPR1A RS3 alleles and increased arginine vasopressin levels.
25968600 Study identified, in OXTR and AVPR1A genes, signatures of balancing selection in the cis-regulative acting sequences such as transcription factor binding and enhancer sequences, as well as in a transcriptional repressor sequence motif. Additionally, in the intron 3 of the OXTR gene, the SNP rs59190448 appears to be under positive directional selection.
25707602 The arginine vasopressin receptor 1A gene (AVPR1A) is known to affect social communication and has been reported to associate with autism in several studies.
25529259 AVPR1A RS3 was not associated with schizophrenia; variation in the AVPR1A gene contributes to social behavioral deficits associated with schizophrenia
25476609 examined associations between polymorphisms in OXTR and AVPR1a and individual differences in emotional and cognitive empathy 367 young adults; emotional empathy was associated solely with OXTR, whereas cognitive empathy was associated solely with AVPR1a
25438555 Haplotype analysis revealed an association of AVPR1A C*S- and C*L-haplotype (rs11174811 and RS1, respectively) and increased or decreased Extraversion (EPI) in Bashkirs, respectively.
25016245 Study found that variability in the rs7298346 marker, located in the 5'-flanking region, was related to a composite measure of executive functioning in 4-year-old children after controlling for a variety of covariates and children's theory of mind.
24924430 humanized AVPR1A mice displayed increased reciprocal social interactions compared with wild-type animals.
24849541 Gene-level tests showed that DRD2 was associated with vocabulary, ASPM with vocabulary and reading decoding, and AVPR1A with all three endophenotypes.
24660771 Men, but not women, with high levels of poststressor AVP and the 320 allele of the RS1 polymorphism reported more poststressor anger than noncarriers.
24618689 Early caregiving combined with genetic liability along the axis of vasopressin-oxytocin gene pathways: G x E contributions to PTSD.
24373571 There was moderate statistical evidence for interactions shoulder pain phenotypes between AVPR1A and depressive symptoms, pain catastrophizing, or kinesiophobia
22764113 Human maternal behaviour is associated with arginine vasopressin receptor 1A gene
22457427 greater perceived threat predicted lower commitment to civic duty for individuals with one or two short alleles for AVPR1a rs1, but not for individuals with only long alleles
22384070 analysis of AVPR1A and SLC6A4 polymorphisms in choral singers and non-musicians
22288734 In a sample of European mothers, a microsatellite variant RS3 of the vasopressin 1a receptor gene is associated with maternal sensitivity; this association is strongest under conditions of high maternal early adversity.
22008661 data suggest a possible interrelation between AVR and RS3 gene variants of the AVPR1A gene and impulsive aggression in patients with borderline personality disorder
21980412 AVPR1A variant associated with preschoolers' lower altruistic behavior.
21747049 Our results demonstrate a role for V1A-mediated signaling in the development of heart failure.
21514569 report finds an association between AVPR1A and the risk for DUD.
21307861 A positive association between the AVPR1A haplotype (RS1 and AVR) and active current listening to music (permuted P=0.0019) was observed.
20889332 The importance of subtle, quantitative measures of endophenotype are emphasized in this review of the neural distribution of vasopressin 1a receptor (V1aR), a recent focus for studies of social behavior.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546835 Evidence provided for a possible association between these SNPs and the phenotype of autism spectrum disorders.
20546835 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20452058 The results of this study found a statistically significant association between microsatellites and Korean autism spectrum disorders.
20452058 Observational study of gene-disease association. (HuGE Navigator)
20413116 Possible roles of oxytocin receptor and vasopressin-1alpha receptor in the pathomechanism of dysperistalsis and dysmenorrhea in patients with adenomyosis uteri.
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20142561 polymorphism rs1042615 of the V1a receptor altered body mass index and diastolic pressure in middle-aged and older men and the training-induced responses of DBP and low-density lipoprotein cholesterol, whereas women did not show any of these responses
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19461995 AVPR1A haplotype AVR+RS1 further suggested a positive association with creative functions in music using haplotype-based association test HBAT.
19350216 The amplified region was polymorphic in length in all species investigated. This region could be a marker to further survey functional difference between and within species.
19195791 A role of the AVPR1a gene in contributing to the prepulse inhibition response to auditory stimuli.
19195791 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19056558 Genetic variation of the human arginine vasopressin 1A (AVPR1A) gene is associated with uncoupling of the usual direct relation between glucose and triglycerides and an increased prevalence of diabetes in subjects with a high fat intake or who are obese
19056558 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18765804 report an association between one of the human AVPR1A repeat polymorphisms (RS3) and traits reflecting pair-bonding behavior in men
18765804 Observational study of gene-disease association. (HuGE Navigator)
18655900 AVPR1a has been linked to eating behaviour in both clinical and non-clinical groups, reflecting the social and ritualistic side of eating behaviour.[REVIEW]
18490926 human amygdala function is strongly associated with genetic variation in AVPR1A.
18490926 Observational study of gene-disease association. (HuGE Navigator)
18384079 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17939166 Observational study of gene-disease association. (HuGE Navigator)
17939166 study is the first to report associations between AVPR1A and OXTR genetic variation with life history traits in humans
17728669 Observational study of gene-disease association. (HuGE Navigator)
17696996 This gene contributes to social bonding in lower animals and in human behavior, suggesting a common evolutionary mechanism.
17653244 There is an association of the V1aR SNP-6951 with essential hypertension in nonobese individuals.
17440932 Observational study of gene-disease association. (HuGE Navigator)
16721832 These results suggest that the four SNPs in the promoter region of the V1aR gene may not be useful as genetic markers for platelet aggregation heterogeneity.
16565083 analysis of a pharmacological chaperone ligand that acts on misfolded mutant V(1a) receptors
16520824 Observational study of gene-disease association. (HuGE Navigator)
16520824 This study confirms an association between the AVPR1a gene and autism spectrum disorders and identifies a third microsatellite associated with autism spectrum disorders as well as haplotypes consisting of all three markers.
16333859 molecular dynamics analysis of mechanism of desmopressin binding in vasopressin V2 receptor versus vasopressin V1a and oxytocin receptors
16205790 Observational study of gene-disease association. (HuGE Navigator)
16205790 Association between AVPR1a and SLC6A4 reflects the social communication, courtship, and spiritual facets of the dancing phenotype.
15994199 Glu54 is critical for arginine vasopressin binding by V1aR.
15098001 AVPR1a's exons were screened in 125 independent autistic probands. 2 promoter polymorphisms were typed in 65 autism-affected sibling-pair families. Linkage & linkage disequilibrium were seen in a subset with relatively less severe language impairment.
14757828 examination of interaction with beta-arrestin and trafficking patterns by heterodimerization with V2 vasopressin receptor
14622255 In the wildtype V1aR, Arg46 constrains the inactive conformation of the receptor; on binding AVP this constraint is alleviated, promoting the transition to active V1aR
12869559 residue Phe225, located in transmembrane domain V, directly participates in the binding of the V1a-selective nonpeptide antagonist SR49059
12082568 transmission disequilibrium testing of polymorphism in autism

AA Sequence

MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAVTFAVAVLGNS      1 - 70
SVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGPDWLCRVVKHLQVFGMFASAY     71 - 140
MLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFVLSTPQYFVFSMIEVNNVTKARDCWATFIQP    141 - 210
WGSRAYVTWMTGGIFVAPVVILGTCYGFICYNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVK    211 - 280
SISRAKIRTVKMTFVIVTAYIVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMF    281 - 350
FSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST      351 - 418
//

Text Mined References (76)

PMID Year Title
26295806 2015 Impact of Childhood Adversity and Vasopressin receptor 1a Variation on Social Interaction in Adulthood: A Cross-Sectional Study.
25968600 2015 Signatures of positive selection in the cis-regulatory sequences of the human oxytocin receptor (OXTR) and arginine vasopressin receptor 1a (AVPR1A) genes.
25707602 2015 Association and Promoter Analysis of AVPR1A in Finnish Autism Families.
25529259 2015 Arginine vasopressin 1a receptor RS3 promoter microsatellites in schizophrenia: a study of the effect of the "risk" allele on clinical symptoms and facial affect recognition.
25476609 2015 Oxytocin receptor and vasopressin receptor 1a genes are respectively associated with emotional and cognitive empathy.
25438555 2014 [Arginine-vasopressin receptor gene (AVPR1A, AVPR1B) polymorphisms and their relation to personality traits].
25016245 2014 Association between the arginine vasopressin receptor 1A (AVPR1A) gene and preschoolers' executive functioning.
24924430 2014 Introduction of the human AVPR1A gene substantially alters brain receptor expression patterns and enhances aspects of social behavior in transgenic mice.
24849541 2014 Association between AVPR1A, DRD2, and ASPM and endophenotypes of communication disorders.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24660771 2014 Oxytocin and vasopressin receptor polymorphisms interact with circulating neuropeptides to predict human emotional reactions to stress.
24618689 2014 Affiliation buffers stress: cumulative genetic risk in oxytocin-vasopressin genes combines with early caregiving to predict PTSD in war-exposed young children.
24373571 2014 Biopsychosocial influence on exercise-induced injury: genetic and psychological combinations are predictive of shoulder pain phenotypes.
22764113 2012 Human maternal behaviour is associated with arginine vasopressin receptor 1A gene.
22457427 2012 The neurogenetics of nice: receptor genes for oxytocin and vasopressin interact with threat to predict prosocial behavior.
22384070 2012 AVPR1A and SLC6A4 polymorphisms in choral singers and non-musicians: a gene association study.
22288734 2012 Arginine vasopressin 1a receptor gene and maternal behavior: evidence of association and moderation.
22008661 2012 Variable number of tandem repeat polymorphisms of the arginine vasopressin receptor 1A gene and impulsive aggression in patients with borderline personality disorder.
21980412 2011 AVPR1A variant associated with preschoolers' lower altruistic behavior.
21747049 2011 Controlled and cardiac-restricted overexpression of the arginine vasopressin V1A receptor causes reversible left ventricular dysfunction through G?q-mediated cell signaling.
21514569 2011 The AVPR1A gene and substance use disorders: association, replication, and functional evidence.
21307861 2011 Association of the arginine vasopressin receptor 1A (AVPR1A) haplotypes with listening to music.
20889332 2010 From endophenotypes to evolution: social attachment, sexual fidelity and the avpr1a locus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20546835 2010 Association study between single nucleotide polymorphisms in promoter region of AVPR1A and Korean autism spectrum disorders.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20452058 2010 Family-based association study of microsatellites in the 5' flanking region of AVPR1A with autism spectrum disorder in the Korean population.
20413116 2010 Possible roles of oxytocin receptor and vasopressin-1? receptor in the pathomechanism of dysperistalsis and dysmenorrhea in patients with adenomyosis uteri.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
20142561 2010 Vasopressin V1a receptor polymorphism and interval walking training effects in middle-aged and older people.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19461995 2009 Musical aptitude is associated with AVPR1A-haplotypes.
19350216 2009 Allele distribution and effect on reporter gene expression of vasopressin receptor gene (AVPR1a)-linked VNTR in primates.
19195791 2009 Association between arginine vasopressin 1a receptor (AVPR1a) promoter region polymorphisms and prepulse inhibition.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19056558 2009 Relation between human vasopressin 1a gene variance, fat intake, and diabetes.
18765804 2008 Genetic variation in the vasopressin receptor 1a gene (AVPR1A) associates with pair-bonding behavior in humans.
18655900 2008 Molecular genetic studies of the arginine vasopressin 1a receptor (AVPR1a) and the oxytocin receptor (OXTR) in human behaviour: from autism to altruism with some notes in between.
18490926 2009 Genetic variants in AVPR1A linked to autism predict amygdala activation and personality traits in healthy humans.
18402937 2008 Anti-apoptotic actions of vasopressin in H32 neurons involve MAP kinase transactivation and Bad phosphorylation.
18384079 2008 Combined effects of exonic polymorphisms in CRHR1 and AVPR1B genes in a case/control study for panic disorder.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17939166 2007 AVPR1A and OXTR polymorphisms are associated with sexual and reproductive behavioral phenotypes in humans. Mutation in brief no. 981. Online.
17728669 2007 Association analysis of 15 polymorphisms within 10 candidate genes for antisocial behavioural traits.
17696996 2008 Individual differences in allocation of funds in the dictator game associated with length of the arginine vasopressin 1a receptor RS3 promoter region and correlation between RS3 length and hippocampal mRNA.
17653244 2007 Association of novel promoter single nucleotide polymorphisms in vasopressin V1a receptor gene with essential hypertension in nonobese Japanese.
17440932 2007 Anorexia nervosa, perfectionism, and dopamine D4 receptor (DRD4).
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16721832 2006 Study of V1a vasopressin receptor gene single nucleotide polymorphisms in platelet vasopressin responsiveness.
16565083 2006 Pharmacological chaperone activity of SR49059 to functionally recover misfolded mutations of the vasopressin V1a receptor.
16520824 2006 Association between the arginine vasopressin 1a receptor (AVPR1a) gene and autism in a family-based study: mediation by socialization skills.
16511036 2005 A C-terminal segment of the V1R vasopressin receptor is unstructured in the crystal structure of its chimera with the maltose-binding protein.
16333859 2006 Investigation of mechanism of desmopressin binding in vasopressin V2 receptor versus vasopressin V1a and oxytocin receptors: molecular dynamics simulation of the agonist-bound state in the membrane-aqueous system.
16205790 2005 AVPR1a and SLC6A4 gene polymorphisms are associated with creative dance performance.
15994199 2005 The N-terminal juxtamembrane segment of the V1a vasopressin receptor provides two independent epitopes required for high-affinity agonist binding and signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15098001 2004 Examination of AVPR1a as an autism susceptibility gene.
14757828 2004 Heterodimerization of V1a and V2 vasopressin receptors determines the interaction with beta-arrestin and their trafficking patterns.
14622255 2003 An arginyl in the N-terminus of the V1a vasopressin receptor is part of the conformational switch controlling activation by agonist.
12869559 2003 Identification of the binding sites of the SR49059 nonpeptide antagonist into the V1a vasopressin receptor using sulfydryl-reactive ligands and cysteine mutants as chemical sensors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12436935 2002 Molecular pharmacology and modeling of vasopressin receptors.
12082568 2002 Transmission disequilibrium testing of arginine vasopressin receptor 1A (AVPR1A) polymorphisms in autism.
10858434 2000 Dynamic interaction of human vasopressin/oxytocin receptor subtypes with G protein-coupled receptor kinases and protein kinase C after agonist stimulation.
10756113 2000 Study of V(1)-vascular vasopressin receptor gene microsatellite polymorphisms in human essential hypertension.
10478574 1999 Comparison of vasopressin binding sites in human uterine and vascular smooth muscle cells.
10477084 1999 MCF-7 breast cancer cells express normal forms of all vasopressin receptors plus an abnormal V2R.
9581826 1998 Expression of all known vasopressin receptor subtypes by small cell tumors implies a multifaceted role for this neuropeptide.
9357056 1997 Functional vasopressin V1 type receptors are present in variant as well as classical forms of small-cell carcinoma.
8838314 1996 Structure, sequence, expression, and chromosomal localization of the human V1a vasopressin receptor gene.
8344200 1993 The diurnal rhythm in vasopressin V1a receptor expression in the suprachiasmatic nucleus is not dependent on vasopressin.
8106369 1994 Molecular cloning, sequencing, and functional expression of a cDNA encoding the human V1a vasopressin receptor.
8074728 1994 Cloning, functional expression and tissue distribution of human cDNA for the vascular-type vasopressin receptor.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.