Property Summary

Ligand Count 396
NCBI Gene PubMed Count 81
PubMed Score 215.66
PubTator Score 155.57

Knowledge Summary

Patent (3,152)

Expression

Protein-protein Interaction (1)

Gene RIF (72)

AA Sequence

MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAVTFAVAVLGNS      1 - 70
SVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGPDWLCRVVKHLQVFGMFASAY     71 - 140
MLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFVLSTPQYFVFSMIEVNNVTKARDCWATFIQP    141 - 210
WGSRAYVTWMTGGIFVAPVVILGTCYGFICYNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVK    211 - 280
SISRAKIRTVKMTFVIVTAYIVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMF    281 - 350
FSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST      351 - 418
//

Text Mined References (82)

PMID Year Title