Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.81
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
hepatocellular carcinoma -1.200 3.1e-06
urothelial carcinoma -1.200 5.7e-03
ependymoma -1.100 9.0e-03
glioblastoma -1.100 6.8e-07
group 3 medulloblastoma -2.000 3.9e-06
primitive neuroectodermal tumor -1.200 1.3e-04
adrenocortical carcinoma -1.975 3.4e-07
non-small cell lung cancer -1.042 2.4e-11
intraductal papillary-mucinous adenoma (... 1.600 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.5e-02
lung cancer -2.100 1.0e-04
colon cancer -1.900 1.0e-02
active Crohn's disease -1.342 8.0e-03
breast carcinoma -1.300 1.5e-03
fibroadenoma -1.600 4.3e-02
pediatric high grade glioma -1.100 2.7e-06
pilocytic astrocytoma -1.100 9.1e-07
lung adenocarcinoma -1.060 2.7e-04
inflammatory breast cancer -1.200 1.1e-03
lung carcinoma -1.300 2.9e-17
spina bifida -1.700 2.0e-02
ductal carcinoma in situ -1.200 1.2e-03
invasive ductal carcinoma -1.100 4.5e-03
pituitary cancer -1.300 2.5e-07

Synonym

Accession Q5T686 Q53G32 Q9H2R9 Q9HBN9 AVP-induced protein 1
Symbols VIP32
VIT32
PP5395

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWECAGDHRVAEA      1 - 70
LKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTS     71 - 140
YLHQIRH                                                                   141 - 147
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15140762 2004 AVP-induced VIT32 gene expression in collecting duct cells occurs via trans-activation of a CRE in the 5'-flanking region of the VIT32 gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356727 2002 A novel vasopressin-induced transcript promotes MAP kinase activation and ENaC downregulation.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.