Property Summary

NCBI Gene PubMed Count 211
PubMed Score 8071.15
PubTator Score 8222.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neurohypophyseal diabetes insipidus 13 7.265 3.6

Expression

Protein-protein Interaction (197)

F2RL2   P2RY10   WASL   PIK3C2A   FCHO1   HGS   SYNJ2   NPFF   SYNJ1   TGOLN2   HCRT   HCRTR1   HCRTR2   KALRN   RAMP1   RAMP2   RAMP3   DNAJC6   VAMP4   STAM2   TRIO   EPN2   UTS2   NTSR2   F2   TSHB   CALCA   PTH   VIP   GHRH   TFRC   TF   RLN2   APP   CALCA   NMB   CLTA   CLTB   SCT   NPS   UBB   UBC   SAA1   PTHLH   TSHR   ADCYAP1   RAB5A   TAC1   TRH   TACR2   SYT1   TBXA2R   TACR1   PTAFR   F2R   PIK3R1   HTR2C   NMBR   TACR3   AVPR2   OXTR   NTSR1   NTS   VIPR1   TRHR   PTGER1   PTGER4   AVPR1A   WNT5A   P2RY2   ADCYAP1R1   VIPR2   PIK3CA   PTGFR   PTGER2   PTGIR   GLP1R   LPAR6   SCTR   P2RY1   AVPR1B   XCL1   NMU   PIK3CG   PTH2R   ARRB1   AMPH   DNM2   VAMP7   AGFG1   CLTCL1   F2RL1   UCN   CCL23   PROK1   GNG2   ARPC4   RPS27A   UBA52   VAMP2   QRFP   DAB2   CLTC   PLCB2   OCRL   PLCB3   PTH1R   FCHO2   PTGDR   CRHR2   PICALM   CTTN   GPR176   GAPVD1   P2RY6   PLCB4   ITSN1   VAMP3   SLC18A3   AAK1   NMS   LDLRAP1   FNBP1L   GPRC6A   PIK3R6   KIAA0319   NPSR1   UTS2B   ADM2   SYT9   ARHGEF25   GPHB5   MT-RNR2   GPR65   SYT2   NECAP1   REPS2   PROKR2   GPR150   PROKR1   GPBAR1   STON2   RLN3   PIK3R5   STAM   KISS1R   MCHR2   PTH2   SH3KBP1   REPS1   P2RY11   QRFPR   F2RL3   TAAR1   FNBP1   GPHA2   LPAR4   SH3GL2   SGIP1   VAMP8   NMUR2   NPFFR1   LPAR5   NMUR1   PROK2   PLCB1   GPR84   EPS15L1   XCL2   GHRL   TAC3   OPN4   SLCO3A1   UTS2R   PACSIN2   GPR132   SNX9   NPFFR2   EPN1   BDH2   NIF3L1   CUL2   ATE1   B4GALT6   B4GALT5   MICA   NDUFAF5   GEMIN6   HTRA1   FNTB   CDKN2C   ARSB   NAGLU   ST3GAL4   CHST3   VHL   GALNT18  

Gene RIF (149)

PMID Text
26641207 There was no significant difference in serum copeptin between patients with vasovagal syncope, epilepsy, and controls.
26345979 This study evaluated the relationships among copeptin, ischemia-modified albumin (IMA), and extent of myocardial injury in patients with acute carbon monoxide poisoning.
26341999 This analysis is the first to show a consistent early increase in copeptin at first medical contact in the ambulance and a decrease to routine values within 12-36 h in patients presenting early with spontaneous acute myocardial infarction.
26321369 Data from a population in Sweden suggest association between elevated copeptin plasma levels at time of diagnosis of type 2 diabetes and later development (within 10-12 years) of renal insufficiency and progression to chronic kidney disease stage 3.
26295806 Higher acute vulnerability to stress exists in persons with long AVPR1A RS3 alleles and increased arginine vasopressin levels.
26286191 Copeptin did not vary significantly in complicated vs. uncomplicated community acquired pediatric pneumonia.
26233932 we examined a three-generation Cypriot kindred suspected to have familiar neurohypophyseal diabetes insipidus. Direct sequencing analysis of AVP-NPII identified a missense mutation within the AVP moiety on exon 1 of the gene in all affected family members
26201002 Low serum sodium was associated with an increased risk of cardiovascular and all-cause mortality in type 2 diabetes, but association was not explained by copeptin.
26200852 Findings provide evidence for AVP as a blood-based biomarker of social functioning in children with autism spectrum disorder (ASD), and a promising therapeutic target for ASD in children.
26200092 Data show that silencing of G protein-coupled estrogen receptor-1 (GPER) expression blocks the inhibitory effect of raloxifene on arginine vasopressin (AVP) mRNA levels in SH-SY5Y neuroblastoma cells.
26196577 A positive relationship was found between plasma arginine vasopressin concentration and thirst perception.
26142756 Data suggested that central arginine vasopressin, not peripheral arginine vasopressin might improve the effect of electroacupuncture treatment of primary sciatica in human.
26084546 AVP was most concentrated in the posterior neurohypophysis and ACTH was found predominantly in the anterior adenohypophysis regions.
26069119 Copeptin increases in hemodialysis patients and is higher in patients with LV dysfunction [left ventricular dysfunction ].
25975456 The maternal serum copeptin, MR-proANP and PCT [Procalcitonin] levels are higher in EO-PE [early-onset Preeclampsia] and LO-PE [Late onset Preeclampsia ]patients, but the difference is not significant.
25920022 In diabetic patients, copeptin levels only slightly improves the early diagnosis of acute myocardial infarction.
25918073 Copeptin levels provide a numerically small, but statistically significant incremental value for rapid rule-out of myocardial infarction.
25894585 copeptin as a serum biomarker of febrile seizures
25849778 plasma biomarkers S100-B and copeptin did not improve prediction of poor outcome following seizure
25837320 in Polycystic ovary syndrome patients copeptin was positively correlated and obestatin was negatively correlated with cardiovascular risk factors
25828045 Plasma CT-pro-AVP levels were higher in patients with decreased intravascular volume in severe hyponatremia.
25810383 We therefore posit that AVP represents a missing mechanistic link between initiating events and established midpregnancy dysfunctions that cause preeclampsia. [review]
25740874 Early-onset central diabetes insipidus is associated with de novo mutations of the AVP gene and with hereditary WFS1 gene changes.
25691533 Plasma copeptin, CRP and procalcitonin concentrations were positively correlated with APACHE II score in patients with sepsis, and reflected disease severity.
25618448 These data indicate that copeptin is an independent long-term prognostic marker in HFREF, with possible clinical relevance for multimarker risk prediction algorithms
25472823 Psychological stress leads to a subtle increase in copeptin level.
25383462 Elevated plasma copeptin levels at admission were an independent predictor of long-term mortality after ischemic stroke in a Chinese sample
25252899 The level of copeptin was significantly higher in patients with with community-acquired pneumonia than in healthy children.
25224940 copeptin has been found to be a superior marker when compared with BNP and NT-proBNP in HF patients discharged after hospitalization caused by HF or myocardial infarction (MI).
25224842 Regardless of nutrient type ingested, copeptin did not increase, suggesting values can be interpreted independently of prandial status.
25063055 Copeptin levels were significantly higher in sepsis cases
25038511 plasma copeptin levels independently related to intoxication severity and were identified as a novel biomarker for predicting delayed neurological sequelae after acute CO poisoning
25011650 Plasma copeptin is associated with type 2 diabetes in men but not in women.
25008779 Low cardiac output stimulates AVP release via a non-osmotic process that results in hyponatremia and poor prognosis in patients with stage D HF.
25004250 Sexual disparity of copeptin is already present at birth, indicating increased activation of the AVP system in newborn boys as compared with girls.
25001273 Data indicate that elevated maternal plasma copeptin concentration is a highly significant predictor of preeclampsia throughout pregnancy.
24954239 U-AQP2/P-AVP is a novel predictor of response to TLV in patients with decompensated HF. AQP-defined responders may have a better prognosis on TLV treatment
24937391 Serum levels of cortisol, copeptin, and their ratio could differentiate severe sickle cell anemia from mild or moderate disease.
24905622 copeptin may help in the prediction of progressive hemorrhagic injury and acute traumatic coagulopathy after traumatic brain injury.
24853905 plasma C-terminal pro-arginine vasopressin elevated in pre-eclampsia
24803610 copeptin variations have significant prognostic value from subsequent 90-day death and rehospitalization
24722436 A partial or complete loss of AVP osmoregulation occurs in patients with syndrome of inappropriate antidiuresis.
24699335 Measurement of copeptin does not improve diagnostic sensitivity and reduces specificity of exercise stress test in coronary artery disease patients.
24628831 Copeptin appeared to have an important role in metabolic response and subsequent development of atherosclerosis in insulin resistant, hyperandrogenemic PCOS patients.
24617620 CT-proAVP and MR-proANP have a significant correlation to surrogate markers of the post-cardiac arrest syndrome
24488583 Serum copeptin levels were significantly higher in patients with endometriosis as compared to healthy controls. Moreover, severity of the disease was correlated with serum copeptin levels.
24480183 Circulating copeptin levels were significantly correlated with infarct size in patients with acute myocardial infarction.
24458227 results do not contradict the hypothesis of associations between personality traits and oxytocin-related gene variants; however, there are no statistically significant associations after correcting for multiple testing.
24412107 Patients with poor outcome after aneurysmal subarachnoid hemorrhage have lower AVP and OXT levels in cerebrospinal fluid.
24375010 Higher serum copeptin levels, a surrogate for arginine vasopressin (AVP) release, are associated not only with systolic and diastolic blood pressure but also with several components of metabolic syndrome in hypertensive adolescents.
24270077 Serum copeptin levels link with recurrence of acute exacerbation and all-cause mortality in chronic obstructive pulmonary disease.
24215469 Plasma copeptin was not associated with an increased intima-media-thickness in this cohort. Copeptin levels were related to a lower IMT in men and prediabetics, suggesting that elevated copeptin does not exert proatherogenic effects on carotid arteries.
24184419 Increased plasma copeptin level is associated with disease severity and identified as a novel prognostic marker of local complications, organ failure and mortality after severe acute pancreatitis.
24158882 A novel heterozygous mutation in the AVP gene was found in all examined symptomatic subjects (c.1-33_c.4del37nt) with autosomal dominant familial neurohypophyseal diabetes insipidus (adFNDI)
24156710 Genetic analysis revealed a heterozygous g.279G>A substitution that predicts a p.Ala19Thr substitution in the signal peptide of the AVP prohormone in twins with neurogenic diabetes insipidus.
24086383 dysregulation of OXT, AVP and/or testosterone systems exist in mothers of autistic children.
24023652 Copeptin increases in patients with type 1 diabetes upon insulin induced hypoglycaemia.
23973863 At ROC analysis, apelin and copeptin showed a very good diagnostic profile in identifying ADPKD progression
23958506 copeptin is decreased in patients with more severe nocturnal enuresis
23757433 Data found copeptin to be associated with CV and all-cause mortality in patients with type 2 diabetes treated in primary care.
23589638 oxytocin and argipressin have been referred to as "social" neuropeptides as they have a highly conserved role as mediators of complex social cognition and interaction in both animals and humans
23584859 Findings suggest that estradiol and T regulate arginine-vasopressin (AVP) expression in SH-SY5Y cells through ERs, exerting a stimulatory action via ERalpha and an inhibitory action via ERbeta.
23560938 In cirrhotic patients, copeptin concentrations increased along with the severity of liver disease.
23515451 Data from subjects with syndrome of inappropriate antidiuretic hormone suggest that increase in apelin secretion in chronic heart failure is inappropriate and cannot counterbalance vasopressin overproduction, contributing to abnormal water balance.
23499814 Sstudies indicate that the task of the vasopressin system is homeostasis, a type of process which is fundamental to the brain's regulation of the body, exists in many different systems, and is vital to health and survival.
23402790 Plasma copeptin level increased in children with traumatic brain injury.
23326397 Data show that copeptin may indicate clinical severity of the initial bleeding and may therefore help in guiding treatment decisions in the setting of aneurysmal subarachnoid hemorrhage (aSAH).
23298558 In this review copeptin is described as a novel neurohormone; its use is implicated as a surrogate marker in both cardiovascular and non-cardiac conditions.
23278971 This study demonstrated for the first time a reduction of total AVP but not VIP immunoreactivity in the SCN of patients with a suprasellar tumor inducing visual field defects.
23252994 we found a missense mutation 1516G > T (Gly17Val) in the AVP-NPII gene. the same mutation showed different spectra of age of onsets and urine volumes in a new Chinese family with autosomal dominant neurohypophyseal diabetes insipidus.
23246575 Primary nocturnal eneuresis could be attributed in part to reversed ADH circadian rhythm which may be linked to chromosome 22.
23235301 Plasma AVP concentration may be estimated using thirst perception and/or plasma osmolality via visual analogue scale.
23142954 Serum copeptin concentration constitutes a novel biomarker of degenerative aortic stenosis.
22954353 VP is implicated in interneuronal communication & modulates the hypothalamo-pituitary-adrenal axis, & behavioural functions. VP is involved in the development of anxiety- & depressive-like symptoms. Review.
22921847 In the presence of fetal distress, umbilical cord serum copeptin levels were significantly higher than other groups.
22832391 Neural mechanisms mediating the effect of vasopressin in men are assessed via a random-effects, epoch-related analysis to determine the brain region(s) underlying the influence of vasopressin on social recognition in humans.
22820037 greater plasma vasopressin levels were related to a larger social network, fewer negative marital interactions, less attachment avoidance, more attachment security, and marginally greater spousal social support
22695750 A novel variation in the AVP gene resulting in familial neurohypophyseal diabetes insipidus in a large Italian kindred.
22644838 Of the 15 patients with diabetes insipidus two patients have AVP-NPII mutations
22524462 A novel mutation in the AVP gene predicted to cause a neurophysin II dimerization defect is causing surprisingly late onset of FNDI in a large, six generation, Swedish-Norwegian family.
22516290 Early in autosomal dominant polycystic kidney disease renal concentrating capacity is impaired and AVP/copeptin levels are altered.
22307687 A novel missense mutation in the AVP-NPII gene caused neurohypophyseal diabetes insipidus in this family, due to impaired neurophysin function as a carrier protein for AVP.
22286033 Increased plasma copeptin level is an independent prognostic marker of 1-year mortality, 1-year unfavorable outcome and early neurological deterioration after intracerebral hemorrhage.
22245314 Arginine vasopressin and oxytocin are social hormones and mediate affiliative behaviors in mammals and as recently demonstrated, also in humans--REVIEW
22104994 In triage of chest pain patients, the additional use of copeptin with conventional troponin might allow a rapid and reliable rule-out of the diagnosis of acute myocardial infarction regardless of the pre-test probability.
21960250 [review] AVP and oxytocin play parallel roles in modulating the recognition and avoidance of socially relevant pathogen threats in both humans and rodents.
21915168 A single determination of troponin T high-sensitive and copeptin may enable early and accurate exclusion of acute myocardial infarction in one third of patients, even in an emergency department of a general hospital.
21899794 Report for the first time of a significant genetic association of OXT and AVP with schizophrenia
21834801 Nephrogenic syndrome of inappropriate antidiuresis (NSIAD) is a recently described entity, linked to gain-of-function mutations (R137C and R137L) in arginine vasopressin (AVP) gene leading to chronic activation of tubular V2 AVP receptor (V2R)
21766239 Copeptin has a distinct release pattern in patients with ST-elevation AMI, peaking within the first hour after symptom onset before conventional cardiac biomarkers and falling to normal ranges within the first day.
21752550 Data suggest sex-dependent AVP changes during smoking that could contribute to negative impact of smoking on cardiovascular health.
21677651 In parvocellular-enhanced promoter transgenic mice, acute withdrawal following chronic escalating cocaine dose increases the number of AVP neurons.
21554881 Intranasal administration of arginine vasopressin led to a significant increase in salivary cortisol and pulse rate, specifically when the subjects' task could be negatively judged.
21519298 Copeptin is a reliable surrogate of arginine vasopressin during exercise. Nonosmotic vasopressin stimulation occurs during ultradistance running. Copeptin may better reflect chronic vasopressin secretion under conditions of endurance exercise.
21501333 investigation of copeptin levels in normotensive pregnancy and mild/severe pre-eclampsia: Data suggest that increased maternal copeptin may be involved in pathogenesis of pre-eclampsia and may be useful in assessment of severity of pre-eclampsia.
21498630 This study reports neurohypophyseal diabetes insipidus in a mother and her son due to a novel mutation in Exon 2 of the AVP-NPII gene. Mutation analysis showed a c.322G>T (p.?/p.Glu108X) in Exon 2 of the AVP-NPII gene in both mother and son
21490073 High copeptin levels were significantly associated with components of the metabolic syndrome: high fat intake, low physical activity, and borderline significantly associated with low socioeconomic status.
21216019 Copeptin may be regarded as a promising biochemical marker of arrhythmogenesis in arrhytmia-prone patients with and without heart failure.
21123762 circulating atrial natriuretic peptide modulates AVP secretion, in part, by antagonizing the action of circulating angiotensin II.
21106053 Copeptin, the carboxyl-terminus of the vasopressin prohormone, is elevated in non-survivors of acute dyspnea compared to those who survived.
21088058 a novel mutation in the AVP-NPII gene of patients with Autosomal dominant familial neurohypophyseal diabetes insipidus and growth retardation
20620528 Copeptin in a heart transplant population is independently associated with kidney function and intraventricular septal thickness.
20508186 Copeptin levels are an independent predictor of functional outcome and mortality one year after stroke.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20439785 Elevated copeptin predicts increased risk for diabetes mellitus independently of established clinical risk factors, including fasting glucose and insulin
20413521 Copeptin is an independent predictor of cardiovascular events and appears to at least partly explain the prognostic impact of IGFBP-1 in patients with type 2 diabetes and myocardial infarction
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20144509 These data confirm and extend prior evidence implicating oxytocin and vasopressin in couples' positive and negative communication behaviors, and also provide further evidence of their role in an important health outcome, wound healing.
20010879 men and women with high plasma copeptin have a highly prevalent microalbuminuria in addition to the low level of hydration typical of persons with high vasopressin secretion
19945299 Vasopressin (VP) is a homeostatic neuroendocrine hormone whose chief role is to maintain plasma osmolality. Although important in health, in this review of disease states the breadth of VP's functional repertoire has become widely apparent.
19942636 In depression with above-normal plasma vasopressin (AVP) concentration, a negative correlation was found between plasma AVP and NE concentrations, and no such relation was found in melancholia according to DSM-IV
19897608 Factors beside allelism of AVP-related genes must influence the age of familial neurohypophyseal diabetes insipidus presentation given the founder effect demonstrated for the P26L mutation
19847155 plasma copeptin levels are associated with microalbuminuria, consistent with the hypothesis that vasopressin is involved in urinary albumin excretion
19825939 Dominant pro-vasopressin mutants progressively accumulate as endoplasmic reticulum-associated aggregates.
19821843 The subsequent mutation screen of AVP failed to identify any putative functional polymorphisms in childhood-onset mood disorders.
19821843 Observational study of gene-disease association. (HuGE Navigator)
19672816 Gene expression of vasopressin and oxytocin was significant increased in the hypothalamo-neurohypophysial system of patients with chronic heart failure.
19638944 a negative feedback system between AVP and vasopressin 2 receptor in the endolymphatic sac may function for inner ear fluid homeostasis against stress-induced increases in AVP
19564455 MR-proADM, CT-proET-1, CT-proAVP, and MR-proANP were all elevated in patients with future cardiovascular events and independently correlated to serum creatinine.
19500216 Results indicate that arginine vasopressin and oxytocin gene expression in the paraventricular and supraoptic nuclei is unchanged in depressed Alzheimer's disease patients, in contrast with the enhanced AVP gene expression in major depressive disorder.
19366852 A novel cross-sectional association between plasma copeptin and measures of insulin resistance and metabolic syndrome.
19337789 Report plasma levels of copeptin in patients with coronary heart disease.
19260089 Low nocturnal AVP and urine osmolality may play a role in the pathophysiology of enuretics with nocturnal polyuria.
19129716 Autosomal dominant neurohypophyseal diabetes insipidus in two families. Molecular analysis of the vasopressin-neurophysin II gene and functional studies of three missense mutations.
19114902 data support the hypothesis that impaired AVP response is at least partially responsible for the failure to restore vascular tone in septic shock.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18995178 Correlations between copeptin and left ventricular dysfunction appear stronger at follow-up compared with predischarge, suggesting that the AVP system may have progressive effects on left ventricular impairment over the subsequent period.
18807739 This article reviews mutations of the arginine vasopressin neurophysin-II gene in familial neurohypophyseal diabetes insipidus patients.
18673414 Data demonstrate need for autophagy-mediated degradation of toxic, mutated arginine vasopressin C98X peptides, and suggest that, in the presence of mis-folded proteins, the stimulation of Akt signalling counteracts autophagy and precipitates cell death.
18494865 Observational study of genetic testing. (HuGE Navigator)
18384079 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18316776 Presence of this mutation suggests that the portion of the neurophysin peptide encoded by this sequence is important for the appropriate expression of vasopressin.
18272843 there is a relationship between plasma osmolality, plasma apelin and plasma AVP in various states of hydration
18256370 Study suggests that symptomatic intradialytic hypotension patients are unable to mount an appropriate increase in AVP secretion in the setting of hypotension.
18172431 No significant differences are found in the amount of DNA methylation in the vasopressin promoter compared to that of atrial natriuretic peptide, in females with bulemia nervosa.
18092379 Data show AVP was significantly increased in multiple trauma patients and seems to be an integral part of the neuroendocrine response to severe injury. In ICU patients, AVP decreased to moderately elevated levels within 24 h after ED admission.
17927668 These results suggest that the elevation of plasma vasopressin in the acute phase of Meniere's disease is related to the pathogenesis of Meniere's attacks.
16333859 molecular dynamics analysis of mechanism of desmopressin binding in vasopressin V2 receptor versus vasopressin V1a and oxytocin receptors
15624761 In the present study we found decreased vasopressin in several hypothalamic nuclei in vascular dementia indicating diminished production of certain hormones and neurotransmitters.
15203290 Plasma arginine vasopressin (AVP) was determined before the stressor, at the time of maximum ACTH secretion, and 75 min after stress onset. Activation of the HPA system by psychosocial stress is accompanied by an increase in peripheral plasma AVP levels.
14996841 wild-type vasopressin precursor and pathogenic mutants are degraded by the proteasome
12931042 As a result of this mutation cysteine residue is exchanged, which is involved in disulfide bond with cysteine 44 of NPII moiety. Resulting misfolded protein may lead to chronic neurotoxicity by accumulation of these products in endoplasmatic reticulum.
12590641 Non-suppressible release of AVP is crucially involved in the impaired water excretion and hyponatremia seen in elderly patients with secondary adrenal insufficiency.
12403649 demonstrated a novel mechanism for upstream stimulatory factor activation, which contributes to differential vasopressin expression in lung cancer.
12364435 AVP responses to hypotension in adipsic diabetes insipidus are heterogeneous and reflect the site of the lesion causing the diabetes insipidus
12359138 novel mutation substituting cysteine with phenylalanine in one AVP-NPII gene allele in autosomal dominant neurohypophyseal diabetes insipidus
12107248 Autosomal dominant neurohypophyseal diabetes insipidus due to substitution of histidine for tyrosine(2) in the vasopressin moiety of the hormone precursor.
12012274 identification of a missense mutation of the AVP-NPII gene and a novel mutation predicting a truncated protein in the gene in familial central diabetes insipidus
11980620 autosomal dominant neurohypophyseal diabetes insipidus associated with a novel and recurrent mutations in the vasopressin-neurophysin II gene.

AA Sequence

MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTA      1 - 70
EALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAG     71 - 140
ALLLRLVQLAGAPEPFEPAQPDAY                                                  141 - 164
//

Text Mined References (213)

PMID Year Title
26641207 2016 Assessment of endothelin and copeptin as biomarkers for vasovagal syncope.
26345979 2015 Correlations among copeptin, ischemia-modified albumin, and the extent of myocardial injury in patients with acute carbon monoxide poisoning.
26341999 2015 Temporal release pattern of copeptin and troponin T in patients with suspected acute coronary syndrome and spontaneous acute myocardial infarction.
26321369 Association between copeptin and declining glomerular filtration rate in people with newly diagnosed diabetes. The Skaraborg Diabetes Register.
26295806 2015 Impact of Childhood Adversity and Vasopressin receptor 1a Variation on Social Interaction in Adulthood: A Cross-Sectional Study.
26286191 2015 Proadrenomedullin and copeptin in pediatric pneumonia: a prospective diagnostic accuracy study.
26233932 Identification of an AVP-NPII mutation within the AVP moiety in a family with neurohypophyseal diabetes insipidus: review of the literature.
26201002 2015 Is the association of serum sodium with mortality in patients with type 2 diabetes explained by copeptin or NT-proBNP? (ZODIAC-46).
26200852 2015 Arginine Vasopressin Is a Blood-Based Biomarker of Social Functioning in Children with Autism.
26200092 2015 The Selective Estrogen Receptor Modulator Raloxifene Regulates Arginine-Vasopressin Gene Expression in Human Female Neuroblastoma Cells Through G Protein-Coupled Estrogen Receptor and ERK Signaling.
26196577 2014 Estimation of Plasma Arginine Vasopressin Concentration Using Thirst Perception and Plasma Osmolality Values.
26142756 2015 The role of arginine vasopressin in electroacupuncture treatment of primary sciatica in human.
26084546 2015 Profiling of adrenocorticotropic hormone and arginine vasopressin in human pituitary gland and tumor thin tissue sections using droplet-based liquid-microjunction surface-sampling-HPLC-ESI-MS-MS.
26069119 2015 Copeptin in Hemodialysis Patients with Left Ventricular Dysfunction.
25975456 2015 Maternal serum copeptin, MR-proANP and procalcitonin levels at 11-13 weeks gestation in the prediction of preeclampsia.
25920022 2015 Use of copeptin and high-sensitive cardiac troponin T for diagnosis and prognosis in patients with diabetes mellitus and suspected acute myocardial infarction.
25918073 2015 Incremental value of copeptin to highly sensitive cardiac Troponin I for rapid rule-out of myocardial infarction.
25894585 2015 Copeptin as a serum biomarker of febrile seizures.
25849778 2015 Predictive value of S100-B and copeptin for outcomes following seizure: the BISTRO International Cohort Study.
25837320 2015 Circulating levels of obestatin and copeptin in obese and nonobese women with polycystic ovary syndrome.
25828045 2015 CT-pro-AVP as a tool for assessment of intravascular volume depletion in severe hyponatremia.
25810383 2015 Vasopressin: the missing link for preeclampsia?
25740874 2015 Early-onset central diabetes insipidus is associated with de novo arginine vasopressin-neurophysin II or Wolfram syndrome 1 gene mutations.
25691533 2015 Plasma concentrations of copeptin, C-reactive protein and procalcitonin are positively correlated with APACHE II scores in patients with sepsis.
25618448 2015 Copeptin (C-terminal pro arginine-vasopressin) is an independent long-term prognostic marker in heart failure with reduced ejection fraction.
25472823 2015 Copeptin as a stress marker prior and after a written examination--the CoEXAM study.
25383462 2014 Plasma levels of copeptin predict 1-year mortality in patients with acute ischemic stroke.
25252899 2015 Sodium and copeptin levels in children with community acquired pneumonia.
25224940 2014 Copeptin as a biomarker in heart failure.
25224842 2014 Copeptin levels are independent of ingested nutrient type after standardised meal administration--the CoMEAL study.
25063055 2014 Copeptin as a diagnostic biomarker for sepsis-related deaths.
25038511 2014 Plasma copeptin as a predictor of intoxication severity and delayed neurological sequelae in acute carbon monoxide poisoning.
25011650 2015 Plasma copeptin is associated with type 2 diabetes in men but not in women in the population-based KORA F4 study.
25008779 2014 Low cardiac output stimulates vasopressin release in patients with stage d heart failure.
25004250 2014 Sexual disparity of copeptin in healthy newborn infants.
25001273 2014 Vasopressin in preeclampsia: a novel very early human pregnancy biomarker and clinically relevant mouse model.
24954239 2014 Increased urine aquaporin-2 relative to plasma arginine vasopressin is a novel marker of response to tolvaptan in patients with decompensated heart failure.
24937391 2013 Serum levels of copeptin, C-reactive protein and cortisol in different severity groups of sickle cell anaemia.
24905622 2014 Plasma copeptin level predicts acute traumatic coagulopathy and progressive hemorrhagic injury after traumatic brain injury.
24853905 2014 Cardiovascular biomarkers in preeclampsia at triage.
24803610 2014 Copeptin decrease from admission to discharge has favorable prognostic value for 90-day events in patients admitted with dyspnea.
24722436 2014 A copeptin-based classification of the osmoregulatory defects in the syndrome of inappropriate antidiuresis.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24699335 2015 High-sensitivity cardiac troponin T and copeptin assays to improve diagnostic accuracy of exercise stress test in patients with suspected coronary artery disease.
24628831 2014 Copeptin, a surrogate marker for arginine vasopressin, is associated with cardiovascular risk in patients with polycystic ovary syndrome.
24617620 2014 CT-proAVP (copeptin), MR-proANP and Peroxiredoxin 4 after cardiac arrest: release profiles and correlation to outcome.
24488583 2014 Copeptin is associated with the severity of endometriosis.
24480183 2014 Long-term predictive value of copeptin after acute myocardial infarction: a cardiac magnetic resonance study.
24458227 2014 An attempt to identify single nucleotide polymorphisms contributing to possible relationships between personality traits and oxytocin-related genes.
24412107 2014 Vasopressin and oxytocin in CSF and plasma of patients with aneurysmal subarachnoid haemorrhage.
24375010 2014 Serum copeptin levels in adolescents with primary hypertension.
24270077 2014 The value of assessment tests in patients with acute exacerbation of chronic obstructive pulmonary disease.
24215469 2013 Plasma copeptin levels are inversely associated with intima-media-thickness in men: the population-based KORA F4 study.
24184419 2014 Plasma copeptin levels are associated with prognosis of severe acute pancreatitis.
24158882 2013 Dilatative uropathy as a manifestation of neurohypophyseal diabetes insipidus due to a novel mutation in the arginine vasopressin-neurophysin-II gene.
24156710 2013 Late onset of familial neurogenic diabetes insipidus in monozygotic twins.
24086383 2013 Mothers of autistic children: lower plasma levels of oxytocin and Arg-vasopressin and a higher level of testosterone.
24023652 2013 Concentrations of the stress hormone copeptin increase upon hypoglycaemia in patients with type 1 diabetes dependent of hypoglycaemia awareness.
23973863 2013 Apelin and copeptin: two opposite biomarkers associated with kidney function decline and cyst growth in autosomal dominant polycystic kidney disease.
23958506 2013 Copeptin as a novel biomarker in nocturnal enuresis.
23757433 2013 Copeptin, a surrogate marker for arginine vasopressin, is associated with cardiovascular and all-cause mortality in patients with type 2 diabetes (ZODIAC-31).
23589638 2013 Oxytocin and vasopressin: social neuropeptides with complex neuromodulatory functions.
23584859 2013 Estradiol and testosterone regulate arginine-vasopressin expression in SH-SY5Y human female neuroblastoma cells through estrogen receptors-? and -?.
23560938 2013 Plasma copeptin, a possible prognostic marker in cirrhosis.
23515451 2013 An abnormal apelin/vasopressin balance may contribute to water retention in patients with the syndrome of inappropriate antidiuretic hormone (SIADH) and heart failure.
23499814 2013 Information coding in vasopressin neurons--the role of asynchronous bistable burst firing.
23402790 2013 Plasma copeptin concentration and outcome after pediatric traumatic brain injury.
23326397 2013 Copeptin as a marker for severity and prognosis of aneurysmal subarachnoid hemorrhage.
23298558 2013 Copeptin and cardiovascular disease: a review of a novel neurohormone.
23278971 2013 Arginine vasopressin immunoreactivity is decreased in the hypothalamic suprachiasmatic nucleus of subjects with suprasellar tumors.
23252994 2013 A missense mutation in the arginine-vasopressin neurophysin-II gene causes autosomal dominant neurohypophyseal diabetes insipidus in a Chinese family.
23246575 2013 Anti-diuretic hormone and genetic study in primary nocturnal enuresis.
23235301 2012 Relationship between thirst perception and plasma arginine vasopressin concentration in man.
23142954 2013 Copeptin constitutes a novel biomarker of degenerative aortic stenosis.
22954353 2012 Vasopressin in health and disease with a focus on affective disorders.
22921847 2012 Maternal and neonatal copeptin levels at cesarean section and vaginal delivery.
22832391 2011 Vasopressin modulates social recognition-related activity in the left temporoparietal junction in humans.
22820037 2012 Plasma vasopressin and interpersonal functioning.
22695750 2013 A novel variation in the AVP gene resulting in familial neurohypophyseal diabetes insipidus in a large Italian kindred.
22644838 2012 Mutations in the AVPR2, AVP-NPII, and AQP2 genes in Turkish patients with diabetes insipidus.
22524462 2012 Late-onset familial neurohypophyseal diabetes insipidus due to a novel mutation in the AVP gene.
22516290 2012 Vasopressin, copeptin, and renal concentrating capacity in patients with autosomal dominant polycystic kidney disease without renal impairment.
22307687 2012 Clinical and molecular analysis of a Chinese family with autosomal dominant neurohypophyseal diabetes insipidus associated with a novel missense mutation in the vasopressin-neurophysin II gene.
22286033 2012 Copeptin is associated with one-year mortality and functional outcome in patients with acute spontaneous basal ganglia hemorrhage.
22245314 2012 The contributions of oxytocin and vasopressin pathway genes to human behavior.
22104994 2013 Copeptin for rapid rule out of acute myocardial infarction in emergency department.
21960250 2011 Sociality, pathogen avoidance, and the neuropeptides oxytocin and arginine vasopressin.
21915168 2011 Combined determination of highly sensitive troponin T and copeptin for early exclusion of acute myocardial infarction: first experience in an emergency department of a general hospital.
21899794 2012 Oxytocin and vasopressin genes are significantly associated with schizophrenia in a large Arab-Israeli pedigree.
21834801 2012 Lack of responsiveness to 1-desamino-D arginin vasopressin (desmopressin) in male patients with nephrogenic syndrome of inappropriate antidiuresis: from bench to bedside.
21766239 2011 Comparison of the temporal release pattern of copeptin with conventional biomarkers in acute myocardial infarction.
21752550 2011 Sex differences in effects of cigarette smoking and 24-hr abstinence on plasma arginine vasopressin.
21677651 2011 Persistent increase in hypothalamic arginine vasopressin gene expression during protracted withdrawal from chronic escalating-dose cocaine in rodents.
21554881 2011 Vasopressin needs an audience: neuropeptide elicited stress responses are contingent upon perceived social evaluative threats.
21519298 2011 Changes in copeptin and bioactive vasopressin in runners with and without hyponatremia.
21501333 2011 Circulating levels of copeptin, a novel biomarker in pre-eclampsia.
21498630 2011 Familial neurohypophyseal diabetes insipidus due to a novel mutation in the arginine vasopressin-neurophysin II gene.
21490073 2011 Plasma copeptin, a unifying factor behind the metabolic syndrome.
21437268 2011 A genome-wide association study of upper aerodigestive tract cancers conducted within the INHANCE consortium.
21216019 2011 Copeptin (C-terminal provasopressin): a promising marker of arrhythmogenesis in arrhythmia prone subjects?
21123762 2011 Angiotensin II-stimulated secretion of arginine vasopressin is inhibited by atrial natriuretic peptide in humans.
21106053 2010 Copeptin and risk stratification in patients with acute dyspnea.
21088058 2011 Growth retardation in untreated autosomal dominant familial neurohypophyseal diabetes insipidus caused by one recurring and two novel mutations in the vasopressin-neurophysin II gene.
20620528 2010 Copeptin in heart transplant recipients depends on kidney function and intraventricular septal thickness.
20508186 2010 Prognostic value of copeptin: one-year outcome in patients with acute stroke.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20439785 2010 Plasma copeptin and the risk of diabetes mellitus.
20413521 2010 Copeptin, IGFBP-1, and cardiovascular prognosis in patients with type 2 diabetes and acute myocardial infarction: a report from the DIGAMI 2 trial.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
20144509 2010 Marital behavior, oxytocin, vasopressin, and wound healing.
20010879 2010 Determinants of kidney dysfunction: is vasopressin a new player in the arena?
19945299 2010 Vasopressin: a review of therapeutic applications.
19942636 2011 Evidence of vasopressinergic-noradrenergic mechanisms in depression with above-normal plasma vasopressin concentration with and without psychotic features.
19897608 2010 Autosomal recessive familial neurohypophyseal diabetes insipidus: onset in early infancy.
19847155 2010 Copeptin, a surrogate marker of vasopressin, is associated with microalbuminuria in a large population cohort.
19825939 2009 Dominant pro-vasopressin mutants that cause diabetes insipidus form disulfide-linked fibrillar aggregates in the endoplasmic reticulum.
19821843 2009 Further genetic evidence implicates the vasopressin system in childhood-onset mood disorders.
19672816 2010 Comparison of vasopressin and oxytocin expressions in the hypothalamo-neurohypophysial system of patients with chronic heart failure.
19638944 2009 Plasma vasopressin and V2 receptor in the endolymphatic sac in patients with delayed endolymphatic hydrops.
19564455 2009 Endothelial markers may link kidney function to cardiovascular events in type 2 diabetes.
19500216 2009 Hypothalamic vasopressin and oxytocin mRNA expression in relation to depressive state in Alzheimer's disease: a difference with major depressive disorder.
19366852 2009 Plasma carboxy-terminal provasopressin (copeptin): a novel marker of insulin resistance and metabolic syndrome.
19337789 2009 Plasma levels of copeptin in patients with coronary heart disease.
19260089 2009 Nocturnal polyuria and nocturnal arginine vasopressin (AVP): a key factor in the pathophysiology of monosymptomatic nocturnal enuresis.
19129716 2009 Autosomal dominant neurohypophyseal diabetes insipidus in two families. Molecular analysis of the vasopressin-neurophysin II gene and functional studies of three missense mutations.
19114902 2009 The vasopressin and copeptin response to infection, severe sepsis, and septic shock.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18995178 2008 C-terminal provasopressin (copeptin) is associated with left ventricular dysfunction, remodeling, and clinical heart failure in survivors of myocardial infarction.
18807739 [Mutations in the arginine vasopressin neurophysin-II gene in familial neurohypophyseal diabetes insipidus patients].
18673414 2008 Akt induces apoptosis in neuroblastoma cells expressing a C98X vasopressin mutant following autophagy suppression.
18538351 2008 AQP1 gene expression is upregulated by arginine vasopressin and cyclic AMP agonists in trophoblast cells.
18494865 2008 Utility of AVP gene testing in familial neurohypophyseal diabetes insipidus.
18402937 2008 Anti-apoptotic actions of vasopressin in H32 neurons involve MAP kinase transactivation and Bad phosphorylation.
18384079 2008 Combined effects of exonic polymorphisms in CRHR1 and AVPR1B genes in a case/control study for panic disorder.
18316776 2008 Mutation of Glu78 of the AVP-NPII gene impairs neurophysin as a carrier protein for arginine vasopressin in a family with neurohypophyseal diabetes insipidus.
18272843 2008 Reciprocal regulation of plasma apelin and vasopressin by osmotic stimuli.
18256370 2008 Serum vasopressin response in patients with intradialytic hypotension: a pilot study.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18172431 2008 Epigenetic downregulation of atrial natriuretic peptide but not vasopressin mRNA expression in females with eating disorders is related to impulsivity.
18092379 2007 Endogenous vasopressin and copeptin response in multiple trauma patients.
17927668 2007 The relevance of an elevation in the plasma vasopressin levels to the pathogenesis of Meniere's attack.
16971491 2007 Characterization of two splice variants of human organic anion transporting polypeptide 3A1 isolated from human brain.
16333859 2006 Investigation of mechanism of desmopressin binding in vasopressin V2 receptor versus vasopressin V1a and oxytocin receptors: molecular dynamics simulation of the agonist-bound state in the membrane-aqueous system.
15624761 2004 Metabolic alterations in the hypothalamus and basal forebrain in vascular dementia.
15538939 2004 Identification of a novel mutation in the arginine vasopressin-neurophysin II gene affecting the sixth intrachain disulfide bridge of the neurophysin II moiety.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356057 2004 Differential cellular handling of defective arginine vasopressin (AVP) prohormones in cells expressing mutations of the AVP gene associated with autosomal dominant and recessive familial neurohypophyseal diabetes insipidus.
15203290 Arginine vasopressin and adrenocorticotropin secretion in response to psychosocial stress is attenuated by ethanol in sons of alcohol-dependent fathers.
15070970 2004 A novel mutation in the preprovasopressin gene identified in a kindred with autosomal dominant neurohypophyseal diabetes insipidus.
14996841 2004 Degradation of wild-type vasopressin precursor and pathogenic mutants by the proteasome.
14673472 2004 Six novel mutations in the arginine vasopressin gene in 15 kindreds with autosomal dominant familial neurohypophyseal diabetes insipidus give further insight into the pathogenesis.
14660745 2003 A murine model of autosomal dominant neurohypophyseal diabetes insipidus reveals progressive loss of vasopressin-producing neurons.
14607844 2004 Identification and characterization of TRP14, a thioredoxin-related protein of 14 kDa. New insights into the specificity of thioredoxin function.
14579113 2004 Organic anion transporting polypeptides of the OATP/ SLC21 family: phylogenetic classification as OATP/ SLCO superfamily, new nomenclature and molecular/functional properties.
14510916 2003 Progressive decline of vasopressin secretion in familial autosomal dominant neurohypophyseal diabetes insipidus presenting a novel mutation in the vasopressin-neurophysin II gene.
13591312 On the nature of oxytocin and vasopressin from human pituitary.
12931042 2003 A new missense mutation of the vasopressin-neurophysin II gene in a family with neurohypophyseal diabetes insipidus.
12590641 2003 Close association of severe hyponatremia with exaggerated release of arginine vasopressin in elderly subjects with secondary adrenal insufficiency.
12566732 2003 Relationship between adrenomedullin and vasopressin-aquaporin system under general anesthesia.
12519420 2003 A signal peptide mutation of the arginine vasopressin gene in monozygotic twins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403649 2003 Upstream stimulatory factor activates the vasopressin promoter via multiple motifs, including a non-canonical E-box.
12364435 2002 Baroregulation of vasopressin release in adipsic diabetes insipidus.
12359138 A missense mutation encoding Cys73Phe in neurophysin II is associated with autosomal dominant neurohypophyseal diabetes insipidus.
12107248 2002 Autosomal dominant neurohypophyseal diabetes insipidus due to substitution of histidine for tyrosine(2) in the vasopressin moiety of the hormone precursor.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
12012274 2002 Identification of a novel mutation in the arginine vasopressin-neurophysin II gene in familial central diabetes insipidus.
11980620 2002 Clinical and molecular analysis of three families with autosomal dominant neurohypophyseal diabetes insipidus associated with a novel and recurrent mutations in the vasopressin-neurophysin II gene.
11857925 2002 [Nephrogenic diabetes insipidus associated with mutations of vasopressin V2 receptors and aquaporin-2].
11836335 2002 Effects of aging on vasopressin production in a kindred with autosomal dominant neurohypophyseal diabetes insipidus due to the DeltaE47 neurophysin mutation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11748489 2001 A new mutation of the arginine vasopressin-neurophysin II gene in a family with autosomal dominant neurohypophyseal diabetes insipidus.
11713645 2001 Arginine vasopressin regulates CFTR and ClC-2 mRNA expression in rat kidney cortex and medulla.
11443218 2001 Familial neurohypophysial diabetes insipidus in a large Dutch kindred: effect of the onset of diabetes on growth in children and cell biological defects of the mutant vasopressin prohormone.
11384615 2001 Arginine-vasopressin in nucleus of the tractus solitarius induces hyperglycemia and brain glucose retention.
11161827 2001 A missense mutation encoding cys(67) --> gly in neurophysin ii is associated with early onset autosomal dominant neurohypophyseal diabetes insipidus.
11150885 2000 A novel arginine vasopressin-neurophysin II mutation causes autosomal dominant neurohypophyseal diabetes insipidus and morphologic pituitary changes.
11017955 2000 Identification of two distinct mutations at the same nucleotide position, concomitantly with a novel polymorphism in the vasopressin-neurophysin II gene (AVP-NP II) in two dutch families with familial neurohypophyseal diabetes insipidus.
10677561 2000 Familial neurohypophyseal diabetes insipidus associated with a novel mutation in the vasopressin-neurophysin II gene.
10487710 1999 Molecular analysis in familial neurohypophyseal diabetes insipidus: early diagnosis of an asymptomatic carrier.
10443701 1999 Clinical and molecular evidence of abnormal processing and trafficking of the vasopressin preprohormone in a large kindred with familial neurohypophyseal diabetes insipidus due to a signal peptide mutation.
10369876 1999 Autosomal recessive familial neurohypophyseal diabetes insipidus with continued secretion of mutant weakly active vasopressin.
9814475 1998 Two novel mutations of the vasopressin gene associated with familial diabetes insipidus and identification of an asymptomatic carrier infant.
9580132 1998 Identification of a novel nonsense mutation and a missense substitution in the vasopressin-neurophysin II gene in two Spanish kindreds with familial neurohypophyseal diabetes insipidus.
9467595 1998 Identification of mutations of the arginine vasopressin-neurophysin II gene in two kindreds with familial central diabetes insipidus.
9360520 1997 Autosomal dominant neurohypophyseal diabetes insipidus associated with a missense mutation encoding Gly23-->Val in neurophysin II.
8989232 1997 Heterogeneity in clinical manifestation of autosomal dominant neurohypophyseal diabetes insipidus caused by a mutation encoding Ala-1-->Val in the signal peptide of the arginine vasopressin/neurophysin II/copeptin precursor.
8945633 1996 Heterologous expression of human vasopressin-neurophysin precursors in a pituitary cell line: defective transport of a mutant protein from patients with familial diabetes insipidus.
8794883 1996 A fully active nonglycosylated V2 vasopressin receptor.
8626836 1996 A new type of familial central diabetes insipidus caused by a single base substitution in the neurophysin II coding region of the vasopressin gene.
8554046 1996 Identification of 13 new mutations in the vasopressin-neurophysin II gene in 17 kindreds with familial autosomal dominant neurohypophyseal diabetes insipidus.
8550751 1996 A novel point mutation in the translation initiation codon of the pre-pro-vasopressin-neurophysin II gene: cosegregation with morphological abnormalities and clinical symptoms in autosomal dominant neurohypophyseal diabetes insipidus.
8514868 1993 Possible involvement of inefficient cleavage of preprovasopressin by signal peptidase as a cause for familial central diabetes insipidus.
8370682 1993 Familial neurohypophyseal diabetes insipidus associated with a signal peptide mutation.
8106369 1994 Molecular cloning, sequencing, and functional expression of a cDNA encoding the human V1a vasopressin receptor.
8103767 1993 Glu-47, which forms a salt bridge between neurophysin-II and arginine vasopressin, is deleted in patients with familial central diabetes insipidus.
8045958 1994 A de novo mutation in the coding sequence for neurophysin-II (Pro24-->Leu) is associated with onset and transmission of autosomal dominant neurohypophyseal diabetes insipidus.
7929452 1994 Molecular cloning and functional expression of a cDNA encoding the human V1b vasopressin receptor.
7921229 1994 Histamine- and stress-induced prolactin secretion: importance of vasopressin V1- and V2-receptors.
7714110 1995 Two novel mutations in the coding region for neurophysin-II associated with familial central diabetes insipidus.
7271787 1981 The complete sequence of a novel human pituitary glycopeptide homologous to pig posterior pituitary glycopeptide.
6574452 1983 Identification of human neurophysins: complete amino acid sequences of MSEL- and VLDV-neurophysins.
6153132 1980 Synthesis, transport, and release of posterior pituitary hormones.
4065330 1985 Expression of the vasopressin and oxytocin genes in human hypothalami.
3768139 1986 The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation.
3390991 1988 Sweat tests in patients with diabetes insipidus.
2991279 1985 The human vasopressin gene is linked to the oxytocin gene and is selectively expressed in a cultured lung cancer cell line.
2874053 1986 Arginine vasopressin as a central neurotransmitter.
2521920 1989 Arginine vasopressin enhances pHi regulation in the presence of HCO3- by stimulating three acid-base transport systems.
1978246 1990 Linkage relationships of human arginine vasopressin-neurophysin-II and oxytocin-neurophysin-I to prodynorphin and other loci on chromosome 20.
1968469 1990 Molecular analysis of autosomal dominant neurohypophyseal diabetes insipidus.
1840604 1991 A single base substitution in the coding region for neurophysin II associated with familial central diabetes insipidus.
1740104 1992 A missense mutation in the vasopressin-neurophysin precursor gene cosegregates with human autosomal dominant neurohypophyseal diabetes insipidus.