Property Summary

NCBI Gene PubMed Count 24
PubMed Score 28.90
PubTator Score 25.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.800 1.2e-03
malignant mesothelioma -1.500 4.1e-07
Multiple myeloma 1.176 9.5e-03
ovarian cancer 2.700 5.9e-06
psoriasis 1.700 7.3e-05

Gene RIF (19)

AA Sequence

MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGG      1 - 70
APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTD     71 - 140
FSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLE    141 - 210
VPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGD    211 - 280
HLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTE    281 - 350
EELEDWLDSMIS                                                              351 - 362
//

Text Mined References (30)

PMID Year Title