Property Summary

NCBI Gene PubMed Count 23
PubMed Score 28.19
PubTator Score 25.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.176 9.5e-03
malignant mesothelioma -1.500 4.1e-07
psoriasis 1.700 7.3e-05
lung cancer 2.000 3.4e-04
ovarian cancer 2.700 5.9e-06

Synonym

Accession Q9NQS1
Symbols PDCD12

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

PMID Text
26267306 The Aven RGG/RG motif bound G4 structures within the coding regions of the MLL1 and MLL4 mRNAs increasing their polysomal association and translation, resulting in the induction of transcription of leukemic genes.
25757065 The findings implicate Aven in ATR-Chk1 signalling and point towards Chk1 inhibition as a strategy to sensitize human osteosarcomas to chemotherapy.
25573060 the expression of Aven is regulated by the Akt signaling pathway through cathepsin D activity, which contributes to the sensitivity of cancer cells to chemotherapeutic agents.
22751129 Overexpression of the anti-apoptotic protein AVEN contributes to increased malignancy in hematopoietic neoplasms.
22388353 a model of Aven activation by which its N-terminal inhibitory domain is removed by CathD-mediated proteolysis, thereby unleashing its cytoprotective function.
21718987 The results suggest that deregulation of the expression of the apoptosis inhibitor Aven may be related to male factor infertility.
20935510 Results suggest that the regulation of Exportin-1/CRM1-dependent nucleocytoplasmatic traffic of Aven could modulate its ability to influence cell cycle progression.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20030919 the expression level of aven mRNA in de novo AML patients obviously increases
19913121 Observational study of gene-disease association. (HuGE Navigator)
19096130 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18571408 These results identify Aven as a new ATM activator and describe a positive feedback loop operating between Aven and ATM; in aggregate, these findings place Aven, a known apoptotic inhibitor, as a critical transducer of the DNA-damage signal.
18303113 point mutation observed by transcriptome sequencing of malignant pleural mesothelioma tumors
16388850 Aven expression was found to be higher in patients >or=10 years old or <1 year, and with unfavorable cytogenetic abnormalities. It was also significantly higher in relapsed patients in the standard-risk group and an independent poor prognostic factor.

AA Sequence

MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGG      1 - 70
APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTD     71 - 140
FSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLE    141 - 210
VPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGD    211 - 280
HLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTE    281 - 350
EELEDWLDSMIS                                                              351 - 362
//

Text Mined References (29)

PMID Year Title
26267306 2015 Aven recognition of RNA G-quadruplexes regulates translation of the mixed lineage leukemia protooncogenes.
25757065 2015 Aven-mediated checkpoint kinase control regulates proliferation and resistance to chemotherapy in conventional osteosarcoma.
25573060 2015 Akt regulation of Aven contributes to the sensitivity of cancer cells to chemotherapeutic agents.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22751129 2013 Overexpression of the anti-apoptotic protein AVEN contributes to increased malignancy in hematopoietic neoplasms.
22388353 2012 The Apaf-1-binding protein Aven is cleaved by Cathepsin D to unleash its anti-apoptotic potential.
21718987 2011 Apoptosis-inhibitor Aven is downregulated in defective spermatogenesis and a novel estrogen target gene in mammalian testis.
20935510 2010 Regulation of the ATM-activator protein Aven by CRM1-dependent nuclear export.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20030919 2009 [Expression of antiapoptotic gene aven in de novo acute myeloid leukemia patients and its clinical significance].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19096130 2008 Microsatellite scan identifies new candidate genes for susceptibility to alcoholic chronic pancreatitis in Japanese patients.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18571408 2008 Aven-dependent activation of ATM following DNA damage.
18303113 2008 Transcriptome sequencing of malignant pleural mesothelioma tumors.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16388850 2006 Aven overexpression: association with poor prognosis in childhood acute lymphoblastic leukemia.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10949025 2000 Aven, a novel inhibitor of caspase activation, binds Bcl-xL and Apaf-1.