Property Summary

Ligand Count 605
NCBI Gene PubMed Count 313
PubMed Score 803.45
PubTator Score 511.75

Knowledge Summary

Patent (44,319)

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.048 2.0e-02
Atopic dermatitis 1.700 4.7e-05
atypical teratoid / rhabdoid tumor 2.600 3.1e-09
Breast cancer 1.200 7.7e-08
Endometriosis 1.204 1.8e-02
glioblastoma 1.900 1.3e-07
group 3 medulloblastoma 3.200 6.9e-09
invasive ductal carcinoma 1.500 1.1e-04
lung cancer 1.500 9.9e-05
malignant mesothelioma 2.100 2.2e-07
medulloblastoma, large-cell 3.100 2.2e-07
non-small cell lung cancer 2.629 3.9e-27
osteosarcoma -2.285 2.4e-03
pediatric high grade glioma 1.800 6.1e-06
posterior fossa group A ependymoma 1.300 2.5e-04
primitive neuroectodermal tumor 3.000 5.0e-06
psoriasis 1.100 2.6e-37

Gene RIF (271)

AA Sequence

MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTR      1 - 70
HFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRL     71 - 140
YNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRDIKPENLLLGL    141 - 210
KGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNE    211 - 280
TYRRIVKVDLKFPASVPMGAQDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA          281 - 344
//

Text Mined References (329)

PMID Year Title