Property Summary

NCBI Gene PubMed Count 556
PubMed Score 1158.02
PubTator Score 959.65

Knowledge Summary

Patent (76,823)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2388 5.447 2.7
Disease Target Count Z-score Confidence
Measles 22 4.819 2.4
Retinitis pigmentosa 62 3 4.373 2.2
Donohue syndrome 6 4.292 2.1
Disease Target Count
Carcinoma of colon 32
Kidney cancer 2548

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma 1.694 1.3e-04
adult high grade glioma 1.500 1.8e-04
Atopic dermatitis 1.400 3.7e-04
atypical teratoid / rhabdoid tumor 2.200 3.0e-09
Breast cancer 2.700 4.3e-02
breast carcinoma 1.400 2.2e-05
colon cancer 2.100 3.7e-02
cutaneous lupus erythematosus 1.100 4.0e-02
ductal carcinoma in situ 1.800 1.4e-03
Endometriosis 1.410 6.7e-03
esophageal adenocarcinoma 1.300 3.0e-02
glioblastoma 1.900 8.1e-09
group 3 medulloblastoma 2.200 9.4e-05
interstitial cystitis 1.100 1.2e-02
intraductal papillary-mucinous carcinoma... 2.100 1.2e-03
intraductal papillary-mucinous neoplasm ... 2.500 5.0e-04
invasive ductal carcinoma 2.400 1.6e-04
lung adenocarcinoma 1.300 2.1e-08
lung cancer 2.900 5.7e-04
medulloblastoma, large-cell 2.300 2.0e-07
nasopharyngeal carcinoma 1.200 1.2e-04
non-small cell lung cancer 2.633 1.8e-29
osteosarcoma -2.593 4.2e-03
ovarian cancer 2.400 2.1e-07
pancreatic cancer 1.300 5.0e-04
posterior fossa group A ependymoma 1.100 2.9e-03
primitive neuroectodermal tumor 2.200 2.7e-05
psoriasis 1.100 4.7e-05

Synonym

Accession O14965 E1P5F9 O60445 O75873 Q9BQD6 Q9UPG5
Symbols AIK
ARK1
AURA
BTAK
STK6
STK7
STK15
PPP1R47

Gene

PDB

1OL5   3E5A   3HA6   4C3P   5LXM   1MQ4   1MUO   1OL6   1OL7   2BMC   2C6D   2C6E   2DWB   2J4Z   2J50   2NP8   2W1C   2W1D   2W1E   2W1F   2W1G   2WQE   2WTV   2WTW   2X6D   2X6E   2X81   2XNE   2XNG   2XRU   3COH   3EFW   3FDN   3H0Y   3H0Z   3H10   3K5U   3LAU   3M11   3MYG   3NRM   3O50   3O51   3P9J   3QBN   3R21   3R22   3UNZ   3UO4   3UO5   3UO6   3UOD   3UOH   3UOJ   3UOK   3UOL   3UP2   3UP7   3VAP   3W10   3W16   3W18   3W2C   4B0G   4BN1   4BYI   4BYJ   4C3R   4CEG   4DEA   4DEB   4DED   4DEE   4DHF   4J8M   4J8N   4JAI   4JAJ   4JBO   4JBP   4JBQ   4O0S   4O0U   4O0W   4PRJ   4UTD   4UYN   4UZD   4UZH   4ZS0   4ZTQ   4ZTR   4ZTS   5AAD   5AAE   5AAF   5AAG   5DN3   5DNR   5DOS   5DPV   5DR2   5DR6   5DR9   5DRD   5DT0   5DT3   5DT4   5EW9   5G1X   5L8J   5L8K   5L8L   5OBJ   5OBR   5ONE   5ORL   5ORN   5ORO   5ORP   5ORR   5ORS   5ORT   5ORV   5ORW   5ORX   5ORY   5ORZ   5OS0   5OS1   5OS2   5OS3   5OS4   5OS5   5OS6   5OSD   5OSE   5OSF  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (523)

AA Sequence

MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKP      1 - 70
VQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLG     71 - 140
KGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLIL    141 - 210
EYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH    211 - 280
APSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPD    281 - 350
FVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS                     351 - 403
//

Text Mined References (577)

PMID Year Title