Property Summary

NCBI Gene PubMed Count 493
PubMed Score 1012.58
PubTator Score 959.65

Knowledge Summary

Patent (76,823)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 1.58303147412601E-158
breast carcinoma 1614 2.19386102486389E-40
non-small cell lung cancer 2798 1.01487413295475E-29
atypical teratoid / rhabdoid tumor 4369 3.01140242252531E-9
glioblastoma 5572 1.82972436570741E-8
lung adenocarcinoma 2714 5.52268494027638E-8
medulloblastoma, large-cell 6234 2.04388017222763E-7
group 3 medulloblastoma 2254 2.78760017522281E-6
pediatric high grade glioma 2712 4.04303612918788E-6
lung cancer 4473 1.86736347677763E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.95035405070267E-5
ovarian cancer 8492 2.03226948548673E-5
adrenocortical carcinoma 1427 2.13069935642851E-5
primitive neuroectodermal tumor 3031 2.61267901755244E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.79408779782282E-5
Atopic dermatitis 944 7.41269548428195E-5
nasopharyngeal carcinoma 1056 8.19495824782374E-5
invasive ductal carcinoma 2950 1.44536075416508E-4
pancreatic cancer 2300 5.02635418670486E-4
ductal carcinoma in situ 1745 0.00122439188067203
posterior fossa group A ependymoma 1511 0.00285482550128225
osteosarcoma 7933 0.0041769639254757
Endometriosis 535 0.00665278127062265
interstitial cystitis 2299 0.0122580219965469
esophageal adenocarcinoma 737 0.0196023446516811
Breast cancer 3099 0.0242765441600875
colon cancer 1475 0.0365040111752786
cutaneous lupus erythematosus 1056 0.0399369603174076
Disease Target Count Z-score Confidence
Cancer 2346 5.352 2.7
Disease Target Count Z-score Confidence
Measles 20 4.787 2.4
Donohue Syndrome 6 4.355 2.2
Disease Target Count
Carcinoma of colon 32
Kidney cancer 121

Expression

Synonym

Accession O14965 E1P5F9 O60445 O75873 Q9BQD6 Q9UPG5
Symbols AIK
ARK1
AURA
BTAK
STK6
STK7
STK15
PPP1R47

Gene

PDB

1OL5   3E5A   3HA6   4C3P   1MQ4   1MUO   1OL6   1OL7   2BMC   2C6D   2C6E   2DWB   2J4Z   2J50   2NP8   2W1C   2W1D   2W1E   2W1F   2W1G   2WQE   2WTV   2WTW   2X6D   2X6E   2X81   2XNE   2XNG   2XRU   3COH   3EFW   3FDN   3H0Y   3H0Z   3H10   3K5U   3LAU   3M11   3MYG   3NRM   3O50   3O51   3P9J   3QBN   3R21   3R22   3UNZ   3UO4   3UO5   3UO6   3UOD   3UOH   3UOJ   3UOK   3UOL   3UP2   3UP7   3VAP   3W10   3W16   3W18   3W2C   4B0G   4BN1   4BYI   4BYJ   4C3R   4CEG   4DEA   4DEB   4DED   4DEE   4DHF   4J8M   4J8N   4JAI   4JAJ   4JBO   4JBP   4JBQ   4O0S   4O0U   4O0W   4PRJ   4UTD   4UYN   4UZD   4UZH   4ZS0   4ZTQ   4ZTR   4ZTS   5AAD   5AAE   5AAF   5AAG   5DN3   5DNR   5DOS   5DPV   5DR2   5DR6   5DR9   5DRD   5DT0   5DT3   5DT4   5EW9   5L8J   5L8K   5L8L  

  Ortholog (14)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (466)

PMID Text
27102712 Augmented expression of Aurora kinase-A and Polo-like kinase-1 at the lactogenic switch likely mediates the formation of binucleated cells.
27091106 Aurora A inhibition causes delocalized clustering of Lck at the immunological synapses and decreases its phosphorylation levels thus indicating Aurora A is required for maintaining Lck active during T-cell activation.
27003257 Aurora kinase A has a role in inducing papillary thyroid cancer lymph node metastasis by promoting cofilin-1 activity
26962685 A concomitant AURKA/BRAF and AURKA/MEK targeting overcame MAPK signaling activation-associated resistance signature in BRAF- and NRAS-mutated melanomas, respectively, and elicited heightened anti-proliferative activity and apoptotic cell death.
26884555 Aurora A kinase inhibitor alisertib 60 mg/m(2) per dose for 7 days is tolerable with a standard irinotecan and temozolomide backbone and has promising response and progression-free survival rates in neuroblastoma.
26880200 Ndel1 acts as a novel upstream regulator of the trichoplein-Aurora A pathway to inhibit primary cilia assembly.
26842935 Aurora kinases are important KRAS targets in lung cancer.
26777301 PC4 associates with Aurora A and Aurora B and undergoes phosphorylation, following which PC4 activates both Aurora A and B to sustain optimal kinase activity to maintain the phosphorylation gradient for the proper functioning of the mitotic machinery.
26660542 Combined treatment with aurora kinase inhibitor SNS-314and quercetin-hyaluronic acid hydrogel results in synergistic cytotoxic effects in papillary and medullary thyroid carcinoma cells.
26616283 Boolean modeling identifies Greatwall/MASTL as an important regulator in the AURKA network of neuroblastoma.
More...

AA Sequence

MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKP      1 - 70
VQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLG     71 - 140
KGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLIL    141 - 210
EYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH    211 - 280
APSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPD    281 - 350
FVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS                     351 - 403
//

Text Mined References (513)

PMID Year Title
27102712 2016 Essential role for a novel population of binucleated mammary epithelial cells in lactation.
27091106 2016 Aurora A drives early signalling and vesicle dynamics during T-cell activation.
27003257 2016 Aurora kinase A induces papillary thyroid cancer lymph node metastasis by promoting cofilin-1 activity.
26962685 2016 Overcoming MITF-conferred drug resistance through dual AURKA/MAPK targeting in human melanoma cells.
26884555 2016 Phase I Study of the Aurora A Kinase Inhibitor Alisertib in Combination With Irinotecan and Temozolomide for Patients With Relapsed or Refractory Neuroblastoma: A NANT (New Approaches to Neuroblastoma Therapy) Trial.
26880200 2016 Ndel1 suppresses ciliogenesis in proliferating cells by regulating the trichoplein-Aurora A pathway.
26842935 2016 Aurora kinase targeting in lung cancer reduces KRAS-induced transformation.
26777301 2016 Multifunctional human transcriptional coactivator protein PC4 is a substrate of Aurora kinases and activates the Aurora enzymes.
26660542 2016 New Treatment of Medullary and Papillary Human Thyroid Cancer: Biological Effects of Hyaluronic Acid Hydrogel Loaded With Quercetin Alone or in Combination to an Inhibitor of Aurora Kinase.
26616283 2016 Boolean modeling identifies Greatwall/MASTL as an important regulator in the AURKA network of neuroblastoma.
More...