Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.51
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 5.6e-09
osteosarcoma 7933 1.7e-07
psoriasis 6685 1.7e-04
lung cancer 4473 2.9e-04
glioblastoma 5572 3.4e-04
Multiple myeloma 1327 8.9e-04
astrocytoma 1493 1.5e-03

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.354 8.9e-04
psoriasis -1.600 1.7e-04
osteosarcoma -2.145 1.7e-07
astrocytoma 1.100 1.5e-03
glioblastoma 1.400 3.4e-04
lung cancer 1.200 2.9e-04
ovarian cancer 2.900 5.6e-09

Gene RIF (7)

PMID Text
24039768 Monoubiquitinated AUP1 on the lipid droplet surface specifically induces clustering.
23223569 A novel role for Aup1 in maintenance of intracellular cholesterol homeostasis via mediation of the endoplasmic reticulum associated degradation of HMG-CoA reductase.
23197321 AUP1 targeting signals
21857022 Dual role of ancient ubiquitous protein 1 (AUP1) in lipid droplet accumulation and endoplasmic reticulum (ER) protein quality control.
21127063 The presence of the AUP1-Ube2g2 complex at LDs provides a direct molecular link between LDs and the cellular ubiquitination machinery.
12534237 molecular cloning and sequencing of cDNA and preliminary characterization of protein
12042322 binding of Aup1 plays a crucial role in the alpha(IIb)beta(3) inside-out signaling

AA Sequence

MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVLRRFVVRTMC      1 - 70
AVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTVSESEAESATGRFPGAQLKAPLSPLAF     71 - 140
RMEDTEALPLTPILYPTCQFFFFIFLNIFLLAFSSPGSQPLLNSPPSFVCWSRGFMEMNGRGELVESLKR    141 - 210
FCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSL    211 - 280
FVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSS    281 - 350
FPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT    351 - 420
ASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD                  421 - 476
//

Text Mined References (28)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24039768 2013 Monoubiquitination of ancient ubiquitous protein 1 promotes lipid droplet clustering.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23223569 2013 Ancient ubiquitous protein-1 mediates sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl CoA reductase in lipid droplet-associated endoplasmic reticulum membranes.
23197321 2013 Monotopic topology is required for lipid droplet targeting of ancient ubiquitous protein 1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21857022 2011 Dual role of ancient ubiquitous protein 1 (AUP1) in lipid droplet accumulation and endoplasmic reticulum (ER) protein quality control.
21269460 2011 Initial characterization of the human central proteome.
21127063 2011 Ancient ubiquitous protein 1 (AUP1) localizes to lipid droplets and binds the E2 ubiquitin conjugase G2 (Ube2g2) via its G2 binding region.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18711132 2008 SEL1L nucleates a protein complex required for dislocation of misfolded glycoproteins.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12534238 2002 [A new human cellular protein AUP1. III. The intracellular localization of AUP1 protein in different human and rat cell lines].
12534237 2002 [A new human cellular protein AUP1. II. cDNA cloning, genomic organization of Aup1 gene ans preliminary characterization of human AUP1 protein].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12042322 2002 Ancient ubiquitous protein 1 binds to the conserved membrane-proximal sequence of the cytoplasmic tail of the integrin alpha subunits that plays a crucial role in the inside-out signaling of alpha IIbbeta 3.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8812468 1996 Aup1, a novel gene on mouse chromosome 6 and human chromosome 2p13.