Property Summary

NCBI Gene PubMed Count 22
PubMed Score 102.49
PubTator Score 66.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
3-Methylglutaconic Aciduria, Type I 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Kidney disease 430 0.0 0.9
diabetes mellitus 1728 0.0 0.9
Disease Target Count Z-score Confidence
Barth syndrome 23 3.881 1.9
Tracheomalacia 22 3.459 1.7
Disease Target Count
3-Methylglutaconic Aciduria, Type 1 1

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.600 3.2e-06
astrocytic glioma -1.600 1.4e-02
Astrocytoma, Pilocytic -1.100 4.1e-05
atypical teratoid / rhabdoid tumor -1.100 4.7e-04
ependymoma -1.200 1.5e-06
gastric carcinoma -1.300 3.9e-02
glioblastoma -1.200 3.2e-05
group 4 medulloblastoma -1.200 2.3e-04
medulloblastoma, large-cell -1.500 7.6e-05
oligodendroglioma -1.500 2.5e-02
ovarian cancer -1.900 1.2e-07
pancreatic ductal adenocarcinoma liver m... -1.093 1.0e-02
Pick disease -1.300 4.2e-04
tuberculosis 1.100 1.5e-03
ulcerative colitis -1.400 5.7e-09
urothelial carcinoma -1.100 2.9e-02

Gene RIF (9)

AA Sequence

MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSE      1 - 70
MKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAG     71 - 140
ADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVET    141 - 210
KLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLP    211 - 280
QGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE               281 - 339
//

Text Mined References (27)

PMID Year Title