Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.41
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.9e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 9.2e-04
lung cancer 4740 3.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7
Dental caries 164 0.0 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 9.2e-04
lung cancer -1.300 3.2e-03
osteosarcoma -1.383 2.9e-04

AA Sequence

MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKE      1 - 70
GGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCERRHGSMCRPSPSPVSPASNPR     71 - 140
TSLVQVKTKACLSGHHSASSTSKPFKTPKDNLLTSSSKQHTVFPAKGSRDKPCVPVPVVSLEKIPNLVKA    141 - 210
DGANVKMNSTTTTAVSASSTSSSAVSTPPLIKPVLMSKSVPPSPEKILNGKGILPTTIDKKHQNGTKNSN    211 - 280
KPYRRLSEREFDPNKHCGVLDPETKKPCTRSLTCKTHSLSHRRAVPGRKKQFDLLLAEHKAKSREKEVKD    281 - 350
KEHLLTSTREILPSQSGPAQDSLLGSSGSSGPEPKVASPAKSRPPNSVLPRPSSANSISSSTSSNHSGHT    351 - 420
PEPPLPPVGGDLASRLSSDEGEMDGADESEKLDCQFSTHHPRPLAFCSFGSRLMGRGYYVFDRRWDRFRF    421 - 490
ALNSMVEKHLNSQMWKKIPPAADSPLPSPAAHITTPVPASVLQPFSNPSAVYLPSAPISSRLTSSYIMTS    491 - 560
AMLSNAAFVTSPDPSALMSHTTAFPHVAATLSIMDSTFKAPSAVSPIPAVIPSPSHKPSKTKTSKSSKVK    561 - 630
DLSTRSDESPSNKKRKPQSSTSSSSSSSSSSLQTSLSSPLSGPHKKNCVLNASSALNSYQAAPPYNSLSV    631 - 700
HNSNNGVSPLSAKLEPSGRTSLPGGPADIVRQVGAVGGSSDSCPLSVPSLALHAGDLSLASHNAVSSLPL    701 - 770
SFDKSEGKKRKNSSSSSKACKITKMPGMNSVHKKNPPSLLAPVPDPVNSTSSRQVGKNSSLALSQSSPSS    771 - 840
ISSPGHSRQNTNRTGRIRTLP                                                     841 - 861
//

Text Mined References (13)

PMID Year Title