Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.23
PubTator Score 78.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Spinocerebellar Ataxias 32 0.0 0.0
Disease Target Count
Ataxia, Spinocerebellar 15
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 1 16 6.07 3.0
Omphalocele 24 3.696 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.082 2.2e-04
Amyotrophic lateral sclerosis 1.152 3.7e-06
invasive ductal carcinoma -1.500 6.5e-04
juvenile dermatomyositis 1.483 1.3e-11
medulloblastoma, large-cell -1.700 4.5e-03
ovarian cancer -2.000 6.7e-07

Gene RIF (3)

AA Sequence

MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGARVSLGGDGAEA      1 - 70
ITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQHPGIHYPPLHYAQLPSTSLQFI     71 - 140
GSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPQAPSPAHSFNKAPSATSPSGQ    141 - 210
LPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQSALEAAAANGGQRPRERNLV    211 - 280
RRESEALDSPNSKGEGQGLVPVVECVVDGQLFSGSQTPRVEVAAPAHRGTPDTDLEVQRVVGALASQDYR    281 - 350
VVAAQRKEEPSPLNLSHHTPDHQGEGRGSARNPAELAEKSQARGFYPQSHQEPVKHRPLPKAMVVANGNL    351 - 420
VPTGTDSGLLPVGSEILVASSLDVQARATFPDKEPTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQT    421 - 490
QDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRT    491 - 560
TQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPSQLGPPRERPERTVLGSRELCDSEGKSQPAGE    561 - 630
GSRVVEPSQPESGAQACWPAPSFQRYSMQGEEARAALLRPSFIPQEVKLSIEGRSNAGK               631 - 689
//

Text Mined References (14)

PMID Year Title