Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.52
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.700 1.6e-06
astrocytoma -2.900 8.9e-04
ependymoma -3.500 4.5e-11
oligodendroglioma -2.000 1.6e-02
glioblastoma -3.600 1.4e-05
medulloblastoma -3.600 2.8e-06
cystic fibrosis -1.148 9.1e-04
atypical teratoid / rhabdoid tumor -4.000 8.8e-09
medulloblastoma, large-cell -4.400 3.3e-04
primitive neuroectodermal tumor -3.400 1.0e-03
adrenocortical carcinoma -1.346 1.6e-03
pediatric high grade glioma -2.600 8.4e-05
pilocytic astrocytoma -1.500 2.6e-02
Pick disease -2.000 2.4e-02
ovarian cancer -2.400 1.3e-14
pituitary cancer 2.400 3.8e-03

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18821597 Transgenic overexpression of Attractin-like-1 (Atrnl1), which compensates for loss of ATRN, does not rescue dark-like mutant phenotypes.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

METGGRARTGTPQPAAPGVWRARPAGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQSKPCERTGSCF      1 - 70
SGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFAT     71 - 140
ECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSINS    141 - 210
CPNNCSGHGKCTTSVSVPSQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDC    211 - 280
SLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTPSR    281 - 350
GPLQRYGHSLALYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIME    351 - 420
LDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHGGYKAL    421 - 490
PGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFLAY    491 - 560
DIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKNAGPG    561 - 630
IKCVWNKNHCESWESGNTNNILRAKCPPKTAASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSM    631 - 700
SVKNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRVNSSRENYD    701 - 770
NAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGE    771 - 840
PNDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMWCS    841 - 910
STKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGRGHCIEGSSRGP    911 - 980
MKLIGMHHSEMVLDTNLCPKEKNYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDCMPGYYGD    981 - 1050
PTNGGQCTACTCSGHANICHLHTGKCFCTTKGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSL   1051 - 1120
LQEDDRHHTAINFIANPEQSNKNLDISINASNNFNLNITWSVGSTAGTISGEETSIVSKNNIKEYRDSFS   1121 - 1190
YEKFNFRSNPNITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWA   1191 - 1260
SRRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVLTVFLCLPRGS   1261 - 1330
SGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV                        1331 - 1379
//

Text Mined References (11)

PMID Year Title
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18821597 2008 Genetic and phenotypic studies of the dark-like mutant mouse.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14531729 2003 Characterization of a novel binding partner of the melanocortin-4 receptor: attractin-like protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.