Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.04
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.271 8.1e-04
glioblastoma 1.500 4.9e-04
posterior fossa group B ependymoma 1.500 6.0e-12
pediatric high grade glioma 1.300 7.5e-08
atypical teratoid/rhabdoid tumor 1.100 2.7e-07
pilocytic astrocytoma 1.200 2.3e-07
non primary Sjogren syndrome sicca 1.200 2.8e-02
ovarian cancer -1.500 2.2e-05

 MGI Phenotype (1)

Pathway (1)

Gene RIF (4)

PMID Text
23284715 The yeast two-hybrid screen identifies the HIV-1 Nef interacting human protein all-trans retinoic acid-induced differentiation factor (ATRAID; APR-3) in cells
23036366 APR3 expression is increased significantly with malignant progression of human cervical cervical squamous cell carcinoma (SCC), and thus, it may serve as a potential biomarker to predict prognosis of cervical SCC.
21723284 the effects of NELL-1 on osteoblastic differentiation and proliferation are partly through binding to APR3
17387583 These data suggested that APR3 might be functionally important in certain processes under which NFAT and/or NFkappaB are/is activated.

AA Sequence

MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCCLNQKG      1 - 70
TILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTI     71 - 140
TSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGAT    141 - 210
TLSVSILLWATQRRKAKTS                                                       211 - 229
//

Text Mined References (14)

PMID Year Title
23036366 2013 Increased expression of apoptosis-related protein 3 is highly associated with tumorigenesis and progression of cervical squamous cell carcinoma.
21723284 2011 NELL-1 binds to APR3 affecting human osteoblast proliferation and differentiation.
18388313 2008 SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.
17524364 2007 Apoptosis related protein 3, an ATRA-upregulated membrane protein arrests the cell cycle at G1/S phase by decreasing the expression of cyclin D1.
17387583 2007 Identification of the distinct promoters for the two transcripts of apoptosis related protein 3 and their transcriptional regulation by NFAT and NFkappaB.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10948432 2000 Improved PCR-based subtractive hybridization strategy for cloning differentially expressed genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.