Property Summary

NCBI Gene PubMed Count 346
PubMed Score 513.94
PubTator Score 980.75

Knowledge Summary

Patent (14,037)

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma 1.100 2.0e-02
juvenile dermatomyositis 1.189 1.3e-12
acute quadriplegic myopathy 1.164 2.6e-06
non-small cell lung cancer 1.216 3.1e-17
intraductal papillary-mucinous neoplasm ... 1.400 4.7e-02
colon cancer 1.600 4.9e-02
lung cancer 1.600 7.7e-03
Pick disease -1.400 1.6e-03
ovarian cancer 2.900 2.7e-06
dermatomyositis 1.400 1.1e-03

Protein-protein Interaction (1)

Gene RIF (310)

PMID Text
26940878 These results therefore suggest that whereas DNA polymerase stalling at DNA lesions activates ATR to protect cell viability and prevent apoptosis, the stalling of RNA polymerases instead activates ATR to induce an apoptotic form of cell death in non-cycling cells.
26921499 We suggest that MNNG-stimulated ATR/CHK1 signaling stabilizes E2F3 by S124 phosphorylation, and then E2F3 together with NFY co-transactivate RRM2 expression for DNA repair.
26748709 In conclusion, this study exemplifies cancer-specific synthetic lethality between two proteins in the same pathway and raises the prospect of combining ATR and CHK1 inhibitors as promising cancer therapy.
26695634 The innate immune regulator STAT-5 is shown to regulate transcription of the ATR binding factor TopBP1, and this is critical for the induction of the ATR pathway in human papillomavirus-infected keratinocytes.
26667770 RAD9 has a prominent role in the ATR-Chk1 pathway that is necessary for successful formation of the damage-sensing complex and DNA damage checkpoint signaling.
26620371 ATR controls basal deoxycytidine kinase activity in response to replication stress.
26586433 ATM and ATR depletion reduced assembly of the telomerase complex.
26572502 ATR inhibition rewires cellular signaling networks induced by replication stress.
26567218 the role of both ATM and ATR in DNA repair, cell cycle regulation and apoptosis
26565033 PIAS3 primes ATR for checkpoint activation.
26563132 AZD6738, a novel ATR kinase inhibitor sensitized TP53- or ATM-defective primary chronic lymphocytic leukemia cells to chemotherapy and ibrutinib.
26517239 The combination of cisplatin and ATR inhibitor AZD6738 resolves ATM-deficient lung cancer xenografts.
26486089 Common cancer-associated imbalances in the DNA damage response confer sensitivity to single agent ATR inhibition.
26387736 Data reveals that ATR contains a BH3-like domain and plays a direct antiapoptotic role at mitochondria via interacting with tBid following DNA damage. Its function in the cytoplasm is regulated by Pin-1.
26365377 A key role of ATR in S phase is to coordinate RRM2 accumulation and origin firing.
26261078 ATR is down-regulated by STAT3-regulated microRNA-383 in A431 cells.
26168232 ASIP diminishes agonist-independent MC1R basal signaling whereas HBD3 is a neutral MC1R antagonist that blocks activation by melanocortins.
26124337 The expressions of nuclear/cytoplasmic Ser428-phosphorylated ATR (p-ATR) and Ser1981-phosphorylated ATM (p-ATM) were evaluated.
26061708 rRNA synthesis inhibition activates ATM/ATR pathway in acute lymphoblastic leukemia cells, leading to G2 phase arrest and apoptosis.
26061604 Via activation of the ATM/ATR-Chk1/Chk2 check point pathway.
25980679 A novel role of the checkpoint kinase ATR in leptin signaling.
25966274 These findings indicated that mangiferin inhibits cell cycle progression through the ATR-Chk1 stress response DNA damage pathway, leading to cell cycle arrest at G2/M phase in leukemia cells
25962492 Phosphorylation of ATR and CHK1 did not show significant differences in the three cell groups. Overexpression of SHP-1 in the CNE-2 cells led to radioresistance and the radioresistance was related to enhanced DNA DSB repair.
25916852 Findings demonstrate that TopBP1 and ATR are able to inhibit the synthesis of rRNA and to activate nucleolar stress pathway.
25911100 these pockets were not required for 9-1-1 chromatin localization or ATR-mediated CHK1 activation but were necessary for interactions between HUS1 and its binding partner MYH
25904336 ATR activity in midbody-stage cells links postmitotic genome surveillance to abscission timing and that Chk1 integrates this and other signals upstream of Aurora B to regulate when the final step in the physical separation of daughter cells occurs.
25846551 Mutation in ATR gene is associated with epithelial ovarian cancer growth and drug resistance.
25843623 Results show that ATR-mediated phosphorylation of FANCI, controls dormant origin firing in response to DNA replication stress.
25812484 Activation of both Chk1/2-Cdc25 and p53-p21CIP1/WAF1 via ATM/ATR pathway.
25757065 The findings implicate Aven in ATR-Chk1 signalling and point towards Chk1 inhibition as a strategy to sensitize human osteosarcomas to chemotherapy.
25748550 Trovafloxacin-induced liver injury results from ERK and ATR activation in hepatocytes initiated by interaction of TNF-alpha signaling with drug-induced replication stress.
25694603 These data suggest that the activation of both the ATM- and ATR-mediated DNA damage response pathways is linked to viral BK polyomavirus DNA replication.
25497328 ATR pathway plays a pivotal role in regulation of ionizing radiation-induced early G2/M arrest when ATM is deficient/mutant or not fully activated. ATR pathway function in an ATM-independent but DSB complexity-dependent way.
25483091 our results clearly demonstrate that ATR function is required for the IR-induced G2/M checkpoint activation and subsequent survival of cells with ATM deficiency
25468710 ATR and CHEK1 are promising biomarkers and rational drug targets for personalized therapy in breast cancer.
25459351 PhosphoChk1 and H2AX are useful biomarkers for ATR inhibition using a variety of immuno-detection methods, but timing may be critical
25397632 The ATM/ATR protein kinases phosphorylates Fe65 Ser228 and thus inhibits gene transcription.
25380827 The ATR-mediated DNA damage response regulates replication and different tolerance pathways
25336189 These compounds all inhibited ATR-selective phosphorylation and sensitized p53-deficient cancer cells to DNA-damaging agents in vitro and in vivo.
25320300 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
25301947 Phosphorylation of BRIT1 protein coordinates TopBP1 protein recruitment and amplifies ATR signaling in cell DNA damage.
25288669 DNA double-strand breaks by Cr(VI) are targeted to euchromatin and cause ATR-dependent phosphorylation of histone H2AX and its ubiquitination.
25269479 The combination of Top1 inhibitors with VE-821 inhibited the phosphorylation of ATR and Chk1.
25232030 These data suggest that single-agent ATR inhibitors have therapeutic utility and that ATR uses a complex and coordinated set of proteins to maintain genomic stability that could be further exploited.
25083873 Observations suggest that ATR mediates a mechanical response to membrane stress that could be caused by chromatin dynamics and is important for genome integrity.
24971543 These data suggest that v-Src attenuates ATR-Chk1 signaling through the inhibition of Rad17-Rad9 interaction.
24950377 Loss of Ser435 within ATR prevents PKA-mediated ATR phosphorylation, disrupts ATR-XPA binding, delays recruitment of XPA to UV-damaged DNA, and elevates UV-induced mutagenesis.
24901225 A single amino acid change at position 1333, in a region outside of the known regulatory domains, is sufficient to alter ATR kinase activities.
24799566 a novel and critical role for ATR as a mediator of antiviral responses utilizing LT.
24795708 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
24752797 Low expression of ATR was associated with serous ovarian cancer.
24744753 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
24726882 ATM/ATR pathway plays an important role in tumor recognition.
24700029 The ATR checkpoint pathway causes a histone chaperone normally associated with the replication fork, ASF1a, to degrade through a CRL1(betaTRCP)-dependent ubiquitination/proteasome pathway, leading to the localized dechromatinization and gene repression.
24682951 Single-stranded DNA arisen from stalled replication forks can cause the ATR-mediated induction of phosphorylated H2AX.
24672057 depletion of genes within the ataxia telangiectasia and Rad3 related (ATR) and BRCA1/BRCA2 pathways, chromatin modification, and transcription-coupled repair reduced the synergy between mitomycin C and MLN4924
24662920 Loss of the structure-specific endonuclease ERCC1-XPF (ERCC4) is synthetic lethal with ATR pathway inhibitors. ERCC1-deficient cells exhibited elevated levels of DNA damage.
24639502 STAT3 interrupts ATR-to-Chk1 signaling by promoting loss of Claspin, a protein that assists ATR to phosphorylate Chk1.
24634213 Data indicate that inhibition of Src activity induces persistent activation of ataxia telangiectasia mutated (ATM)- and Rad3-related (ATR) and check point kinase 1 (Chk1).
24327542 Distal 11q loss is a useful biomarker in OSCC for radioresistance that can be reversed by ATR-CHEK1 pathway inhibition.
24267891 ATR-mediated suppression of dormant origins shields active forks against irreversible breakage via preventing exhaustion of nuclear RPA. This study elucidates how replicating genomes avoid destabilizing DNA damage.
24238855 investigated if differential processing of breaks induced by low and high LET radiation augments switching from ATM to ATR and NHEJ to HR transition at DNA damage sites; results support the hypothesis that transition from ATM to ATR signaling at DNA break sites is extended for longer periods of time, indicated by sustained resection due to complex type of damage induced
24158819 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
24098119 HSV-1 single stranded DNA binding protein (ICP8), and the helicase/primase complex (UL8/UL5/UL52) form a nuclear complex in transfected cells that is necessary and sufficient to disable ATR signaling.
24045107 Vpr upregulates PVR during Hiv-1 infection by activating ATR kinase that triggers the DNA damage rsponse pathway and G2 arrest.
24045107 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
24005565 HELQ is associated with the RAD51 paralogs RAD51B/C/D and XRCC2, and with the DNA damage-responsive kinase ATR.
23897887 The RAD3-related (ATR) signals the accumulation of replication protein A (RPA)-covered single-stranded DNA (ssDNA), which is caused by replication obstacles.
23874235 We show that fork protection by ATR is crucial to CFS integrity, specifically in the cell type where a given site displays paucity in backup replication origins.
23873943 ATR phosphorylates SMARCAL1 on S652, thereby limiting its fork regression activities and preventing aberrant fork processing
23861882 upon DNA damage transport adaptor importin-alpha4 imports XPA into the nucleus in an ATR-dependent manner.
23844225 common alleles of ATR and CHEK1 are not implicated in breast cancer risk or survival, but we cannot exclude effects of rare alleles and of common alleles with very small effect sizes.
23813879 ATR stabilizes the CDKN1A message in response to UV damage through Cdk1-related cytoplasmic accumulation of HuR.
23807228 A novel regulatory mechanism for ATR gene expression mediated by miR-185.
23733185 Data indicate that 4-Hydroxynonenal (HNE) induces phosphorylation of telangiectasia mutated and Rad3-related protein (ATR) and checkpoint kinase 1 (Chk1).
23698467 Genotoxic stress-induced FANCM phosphorylation is ATR-dependent.
23696651 Treslin is a dual replication/checkpoint protein that directly participates in ATR-mediated checkpoint signaling
23684611 The coordination of these two distinct mechanisms of ATR activation is important for the full function of ATR in the DNA damage response.
23600770 Through the ATR-Chk1-Cdc25C and Weel pathways were the central mechanisms for G2 /M phase arrest in human colon cancer cells.
23592994 ATR activity alleviates breakage of a functional fork as it converges with a stalled fork.
23592782 Following UV irradiation, ataxia telangiectasia-mutated- and Rad3-related protein phosphorylates Bora at Thr-501. The phosphorylated Thr-501 is subsequently recognized by the E3 ubiquitin ligase SCF-beta-TRCP, which targets Bora for degradation.
23548269 Data indicate that interruption of ATR signaling strikingly further sensitized BRCA1- and BRCA2-deficient ovarian cancer cells to PARP inhibition.
23454212 indicate that ATRIP is a direct target gene of HIF-1, and the increased ATRIP then activates the ATR signaling pathway under hypoxia.
23451157 data provides evidence that ATR inhibition is suitable for synthetic lethality application and cisplatin chemopotentiation in XRCC1 deficient ovarian cancer cells
23447702 A feedforward mechanism that leads to G2 arrest identifies ATR and Chk1 as molecular agents of the requisite checkpoint.
23447674 UV-induced G2 checkpoint activation in this situation therefore relies on signalling via the p38 MAPK and ATR-Chk1 signalling cascades.
23438602 hXRCC3 S225 phosphorylation is mediated by ATR via an ATM-dependent signaling pathway.
23401567 ATR-Seckel fibroblasts undergo accelerated aging via stress-induced premature senescence and p38 activation that may underlie certain clinical features of Seckel syndrome.
23345434 as an ATR-associated kinase, Nek1 enhances the stability and activity of ATR-ATRIP before DNA damage, priming ATR-ATRIP for a robust DNA damage response
23284306 Our collective results identify a regulatory pathway involving ETV1, ATR, and TERT that is preferentially important for proliferation of diverse p53- cancer cells
23272087 ATM/ATR inactivation is a crucial step in promoting androgen-induced genomic instability and prostate carcinogenesis
23255133 ATR and CHK1 promote chromosomal stability by different mechanisms
23202519 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
23178497 ATR-mediated phosphorylation induces XPA stabilization by antagonizing HERC2-catalyzed XPA ubiquitination.
23176708 new putative targets under Tel1/Mec1 control
23144622 our analysis exposes an overlapping clinical manifestation between the disorders but allows an expanded spectrum of clinical features for ATR-ATRIP Seckel Syndrome to be defined.
23135710 The ATR pathway in viral replication centers is likely activated through DNA replication stress and might play an important role in engaging cellular DNA repair/recombination machinery for effective human papillomavirus 18 replication.
23085754 ATR controls cellular adaptation to hypoxia through positive regulation of hypoxia-inducible factor 1 (HIF-1) expression.
23029527 ATR, activated after DNA damage, phosphorylates Cdt2 and promotes the rapid degradation of Cdt1 after UV irradiation in the G1 phase of the cell cycle.
22952448 ATM and ATR each contribute to DNA damage response (DDR) activation caused by BKPyV infection.
22948311 In vitro analysis of the role of replication protein A (RPA) and RPA phosphorylation in ATR-mediated checkpoint signaling.
22842784 Dysfunctional telomeres promote ATM/ATR-dependent degradation of CDC25C phosphatase to block mitotic entry, thereby preventing telomere dysfunction-driven genomic instability.
22807682 data demonstrate that beta-HPV E6 expression can enhance the carcinogenic potential of UVB exposure by promoting p300 degradation, resulting in a reduction in ATR levels, which leads to increased thymine dimer persistence and increased UVB induced double strand breaks
22797063 Results reveal a mechanism for the crosstalk between HR repair and NHEJ through the co-regulation of p53-RPA interaction by DNA-PK, ATM and ATR.
22740051 these findings reveal a novel function for sFRP1 as a potent inducer of human Th17-cell differentiation.
22735644 DNA damage triggered the phosphorylation of DBC1 on Thr454 by ATM (ataxia telangiectasia-mutated)
22713662 VE-821 was shown to inhibit ATR-mediated signalling in response to replication arrest induced by severe hypoxia.
22621920 Data indicate that acute myeloid leukemia differentiation can be induced through ATP depletion and the subsequent activation of DNA damage signaling through an ATR/Chk1-dependent and p53-independent pathway.
22556425 hypoxia can activate p53 through inactivation of MDMX by the ATR-Chk1-MDMX-14-3-3gamma pathway.
22535492 FRP1 increases the number of cells expressing tyrosine hydroxylase (a marker for DAdopa;minergic neurons) and betaIII-tubulin (a marker for immature neurons) in the NTera2 and I6 embryonal carcinoma cell lines.
22435685 Studies indicate that the ATR-Chk1-Cdc25 pathway is the sole checkpoint route in a majority of cancer cells.
22341969 Loss of heterozygosity for the ATR locus was noted in oropharyngeal-tumor tissue.
22179839 A novel mechanism of cdc6 regulation in which ATR can have a central role in inhibiting the initiation of DNA replication by the regulation of cdc6.
22174788 Upon DNA damage in S phase, nucleotide excision repair could be regulated by the ATR/p53-dependent checkpoint via modulation of the XPA nuclear import process.
22159421 WRN is involved in the generation of ssDNA and ATR activation in response to camptothecin.
22123827 Dbf4 is direct downstream target of ataxia telangiectasia mutated (ATM) and ataxia telangiectasia and Rad3-related (ATR) protein to regulate intra-S-phase checkpoint.
22084169 The S-phase-specific cyclin-dependent kinase 2 was required for robust activation of ATR in response to diverse chemotherapeutic agents.
21998596 we conclude that, despite being a recessively inherited syndrome, the CtIP mutation encodes a dominant negative protein that impairs ATR activation.
21995812 Chk1 and FANCD2 function downstream of ATR in a non-redundant manner for the establishment and maintenance of psoralen photoactivation-induced senescence.
21994772 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
21976111 results indicate that during the cellular response to low UVC fluences the ATR protein kinase up-regulates p21(WAF1/Cip1) and inhibits apoptosis
21908846 Analysis of mutations that dissociate G(2) and essential S phase functions of human ataxia telangiectasia-mutated and Rad3-related (ATR) protein kinase.
21874023 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
21859891 propose a model in which BID associates with RPA and stimulates the recruitment and/or stabilization of ATR-ATRIP to the DNA damage sensor complex
21857991 Data support a model in which p53 plays an anti-recombinogenic role in the ATR-dependent mammalian replication checkpoint but does not impair a cell's ability to use HR for the removal of DSB induced by cytotoxic agents.
21705319 Thr-1989 phosphorylation is a marker of active ataxia telangiectasia-mutated and Rad3-related (ATR) kinase.
21680529 identified a de novo role for ATR-Chk1 and DNA-PK signaling in B19V DNA replication in primary human erythroid progenitor cells
21659603 We suggest that RHINO functions together with the 9-1-1 complex and TopBP1 to fully activate ATR (ataxia telangiectasia and Rad3-related.
21566061 ATR is a bona fide hsp90 client protein and post-IR administration of AUY922, by inhibiting ATR-CHK1-mediated DDR, sensitizes cancer cells to IR.
21502314 Tethering DNA damage checkpoint mediator proteins topoisomerase IIbeta-binding protein 1 (TopBP1) and Claspin to DNA activates ataxia-telangiectasia mutated and RAD3-related (ATR) phosphorylation of checkpoint kinase 1 (Chk1).
21383502 Genomic DNA damage and ATR-Chk1 signaling determine oncolytic adenoviral efficacy in ovarian cancer cells.
21308861 A novel target to eliminate the tumorigenic CD133(+) cell population in colon cancer and provides another rationale for the development of specific ATR-inhibitors.
21294646 Overexpression of ataxia telangiectasia and rad3-related kinase induces prolonged G2 arrest after exposure to ionizing radiation, which increases resistance to ionizing radiation by enhancing DNA damage repair.
21285353 hMSH2 recruits ATR to DNA damage sites for activation during DNA damage-induced apoptosis.
21284603 ATR is activated by mild hypothermia in mammalian cells and subsequently activates p53.
21270107 p16(INK4A) and p27(Kip1) are key targets in the Atr-dependent signaling pathway in response to UV damage.
21242293 ATR-dependent phosphorylation of poleta is necessary to restore normal survival and postreplication repair after ultraviolet irradiation in xeroderma pigmentosum variant fibroblasts, and is involved in the checkpoint response to UV damage.
21224401 Activation of checkpoint proteins in NER-proficient and NER-deficient cells depends on a common pathway involving the ATR kinase.
21144835 PP5 plays a crucial role in ATR-mediated repair of UV-induced DNA damage.
21034966 ATM-Chk2 and ATR-Chk1 pathways have roles in DNA damage signaling and cancer [review]
20861269 ATR and ATRIP are recruited to herpes simplex virus type 1 replication compartments even though ATR signaling is disabled.
20818375 MLL is phosphorylated at serine 516 by ATR in response to genotoxic stress in the S phase, which disrupts its interaction with, and hence its degradation by, the SCF(Skp2) E3 ligase, leading to its accumulation
20810650 TTI1 and TTI2 exist in multiple complexes, including a 2-MDa complex with TEL2 called the Triple T complex, and phosphoinositide-3-kinase-related protein kinases (PIKKs) such as ataxia telangiectasia-mutated and ataxia-telangiectasia and Rad3-related.
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20616048 describe an in vitro checkpoint system in which replication protein A-single-stranded DNA and TopBP1 are essential for phosphorylation of Chk1 by the purified ATR-ATR-interacting protein complex.
20566845 Data provide insights into how Ad modulates ATR signaling pathways by promoting TOPBP1 degradation during infection.
20515729 studies lead to the suggestion that ATR functions as a sensor of DNA lesions.
20513533 Interaction between BRCA1/BRCA2 and ATM/ATR associate with breast cancer susceptibility.
20513533 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20469721 Phosphorylation of ATM/ATR substrates in eukaryotic cells after infection with Helicobacter pylori
20453000 Observational study of gene-disease association. (HuGE Navigator)
20368801 hESCs have efficient DSB repair that is largely ATR-dependent HRR, whereas astrocytes critically depend on ATM for NHEJ, which, in part, is DNA-PKcs-independent
20347598 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
20233725 RPA-covered ssDNA not only supports recruitment and activation of ATR but also, through Tipin and Claspin, it plays an important role in the action of ATR on its critical downstream target Chk1
20147462 ATR deficiency causes telomere instability both in primary human fibroblasts from Seckel syndrome patients and in HeLa cells.
20103595 the heterogenous ribonucleoprotein A18 signature RNA motif has a role in the 3'-untranslated region of ataxia telangiectasia mutated and Rad3-related (ATR) transcript
20084458 This study implicates the spatiotemporal presence of phosphorylated ATR kinase in the regulation of mRNA splicing and polyadenylation.
20060399 Our results provide novel insight into the mechanism for the regulation of fragile site stability by ATR.
20048340 Human CDC6 physically interacts with ATR, a crucial checkpoint kinase, in a manner that is stimulated by phosphorylation by Cdk and the CDC6-ATR interaction is conserved in Xenopus.
20029092 proliferating cell nuclear antigen, ATR, TopBP1, and Chk1 are recruited to chromatin in a MutLalpha- and MutSalpha-dependent fashion after N-methyl-N'-nitro-N-nitrosoguanidine treatment.
20012529 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
20008788 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
19903823 Abrogation of G(2) arrest by inhibition of ATM and ATR, Chk1, and Wee1 suppressed JCV genome replication.
19828454 Data show that the ATR-dependent phosphorylation of Chk1, but not p53, is strongly stimulated by Claspin.
19798433 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
19633697 These findings show a new function for Cdc5L in the regulation of the ATR-mediated cell-cycle checkpoint in response to genotoxic agents.
19586908 the ATR-XPA interaction mediated by the helix-turn-helix motif of XPA plays an important role in DNA-damage responses to promote cell survival and genomic stability after UV irradiation.
19584262 Investigated the mechanism of ATR up-regulation by COX-2 and tested our hypothesis that COX-2-induced extracellular signal-regulated kinase (ERK) activation mediates up-regulation of ATR by COX-2.
19570909 Data show that disruption of ATR and Chk1 in mismatch repair-deficient cells increased the number of chromosomal abnormalities and enhanced the sensitivity to treatment with 5-fluorouracil.
19536649 Observational study of gene-disease association. (HuGE Navigator)
19527713 Data provide a model of how the ATM/ATR pathway acts as a molecular switch for regulating cell fates, flipping between cell death via progress into mitosis, and over-replication via sustained G2 arrest upon DNA damage
19477925 the restraint of ATR cascade activation may be a novel estrogen action relevant to breast cancer
19470935 ATR mutations in endometrial cancers are associated with biologic aggressiveness as evidenced by reduced disease-free and overall survival
19470935 Observational study of gene-disease association. (HuGE Navigator)
19444312 ATM substrates involved in cell-cycle checkpoint signalling can be minimally phosphorylated independently by ATR, while a small subset of proteins involved in chromatin remodelling are phosphorylated by DNA-PKcs in addition to ATM.
19372558 Deficiency in ATR is associatd with marked sensitivity of the cells to cisplatin in osteosarcoma.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19285939 Single-stranded DNA orchestrates an ATM-to-ATR switch at DNA breaks.
19275588 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
19275579 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
19244116 the NBS1/ATR/BRCA1 repair machinery affects centrosome behavior, and this might be a crucial role in the prevention of malignances.
19242509 relevant target of caffeine is the ATR-Chk1 pathway and that inhibiting ATR or Chk1 might have promise in preventing or reversing UV damage
19197236 The Mre11/Rad50/Nbs1 (MRN) complex is recruited to viral centres only during infection with adenoviruses lacking the early region E4 and ATR signaling is activated.
19154794 Here, we demonstrate that ATR (AT mutated and Rad3 related) activity is essential for maintaining high chromatin levels of the Cdc6 protein, thereby delaying entry into mitosis during hydroxyurea (HU)-induced S-phase arrest of HeLa cells.
19146767 BRCA1, ATR and gammaH2AX in the human may be part of a system which signals unsynapsed chromosomes at pachytene and may lead to their silencing.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19119425 ATR-Chk1 signalling pathway plays a major role in the regulation of death in response to DNA replication stress and that the Chk1-suppressed pathway protecting cells from replication stress is clearly distinguishable from that protecting cells from IR
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19109555 Phosphorylation of FANCA on serine 1449 is a DNA damage-specific event that is downstream of ATR and is functionally important in Fanconi anemia
19097996 HCLK2 functions in the same pathway as TopBP1 but that the two proteins regulate different steps in ATR activation.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064565 Observational study of gene-disease association. (HuGE Navigator)
19004803 These data reveal a highly novel role for ATR in the regulation of global-genomic nucleotide excision repair uniquely during S phase of the cell cycle.
18985806 Ataxia telangiectasia-mutated-Rad3-related DNA damage checkpoint signaling pathway triggered by hepatitis B virus infection.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18936170 Data show that the basic cleft of the RPA70 N-terminal OB-fold domain binds multiple checkpoint proteins, including RAD9, to promote ATR signaling.
18757420 53BP1 bystander foci were induced in an ATR-dependent manner predominantly in S-phase cells, similar to gammaH2AX foci induction
18664457 Nbs1 has a function in ATR signalling in a manner distinct to any role at stalled replication forks. Replication-independent ATR signalling also requires the mediator proteins, 53BP1 and MDC1, providing direct evidence for their role in ATR signalling.
18642075 we determined the methylation statuso f the promoter in putative modifier genes: BRCA1, BRCA2, ATM, ATR and P53 in Jewish BRCA1/BRCA2 mutation carriers with or without breast cancer. hypermethylation was detected only in the BRCA1 promotor
18625709 the ATR-dependent activation of the p38 MAP kinase is a major signaling pathway that induces apoptotic cell death after depletion of Cdc7 in cancer cells
18550533 Chk1 is activated by caspase-mediated cleavage during apoptosis and might be implicated in enhancing apoptotic reactions rather than attenuating the ATR-Chk1 pathway
18536714 Results describe the control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR.
18519640 TopBP1-mediated ATR activation is required for checkpoint signaling and cellular viability
18514189 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
18495871 Mcl-1, perhaps acting as an adaptor protein, in controlling the ATR-mediated regulation of Chk1 phosphorylation
18480045 Chk1 is the primary signal transducer linking activation of the ATM/ATR kinases to Cdc25A destruction in response to ionizing radiation.
18451257 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18451105 Data show that Chk1 and the Claspin-Timeless module of replication forks not only participate in ATR signaling, but also protect stressed forks independently of ATR.
18434539 p53 is activated by stimulation of mismatch repair in response to the misincorporation of deoxynucleotides into newly synthesized DNA, long before the lack of pyrimidine nucleoside triphosphates causes the rate of DNA synthesis to slow appreciably.
18381943 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18357388 role of ATR gene alterations in HL lymphomagenesis.
18245444 ectopic activation of ATR leads to a G1/S arrest in ATM-/- cells, providing the first evidence of functional complementation of ATM deficiency by ATR.
18202016 ATR and DNA-dependent protein kinase cooperate in 2'-C-cyano-2'-deoxy-1-beta-D-arabino-pentofuranosylcytosine-induced activation of the G2 checkpoint pathway
18162465 an important role for the DNA damage response mediated by ATR-Chk2 in p53 activation and renal cell apoptosis during cisplatin nephrotoxicity.
18032786 The increase of cell membranous phosphatidylcholines containing unsaturated fatty acid residues induces phosphorylation of p53 through activation of ATR.
18025301 The ATR-mediated S phase checkpoint prevents replication in mammalian cells when licensing control is disrupted.
18003706 NBS1 mediates ATR-dependent RPA hyperphosphorylation following replication fork stall and collapse.
17976513 This activation of ATR appeared to result from THIF-induced increases in intracellular oxidative stress, a depletion of cellular GSH and an increase in DNA strand breakage.
17934520 Interplay between ATM and ATR in the regulation of common fragile site stability.
17879369 Observational study of gene-disease association. (HuGE Navigator)
17879369 Frequent mutations in MSI-H colon cancers were identified within the ATR damage response pathway.
17716975 ATR/Chk1 pathway is activated at an early time point after the loss of Geminin and contributes to checkpoint arrest
17686975 show that the damage sensor ATR in the presence of topoisomerase II binding protein 1 (TopBP1) mediator/adaptor protein phosphorylates the Chk1 signal-transducing kinase
17638878 ATRIP is a CDK2 substrate, and CDK2-dependent phosphorylation of S224 regulates the ability of ATR-ATRIP to promote cell cycle arrest in response to DNA damage
17616665 a direct physical interaction between BRCA1 and ATRIP is required for the checkpoint function of ATR
17616578 transcription-based stress response involving replication protein A, ATR, and p53 has evolved as a DNA damage-sensing mechanism to safeguard cells against DNA damage-induced mutagenesis
17526493 the Mre11-Rad50-Nbs1 complex plays critical roles both upstream and downstream of ATR to regulate the S-phase checkpoint when replication forks are stalled
17478428 Results suggest that protein ubiquitylation is an important regulatory mechanism downstream of ATM (ataxia telangiectasia-mutated) and ATR (ATM-Rad3-related) activation for checkpoint control.
17409144 EBNA3C can directly regulate the G2/M component of the host cell cycle machinery through ATM/ATR and Chk2, allowing for the release of the checkpoint block
17384681 influence the phosphorylation state of a specific protein substrate of ataxia-telangiectasia mutated (ATM)/ATM- and Rad3-related (ATR) kinases.
17376433 The N-terminus of ATR is sufficient to bind ATRIP and to promote localization to sites of replication stress.
17292679 while ATR mediates the S-phase response, it is not critical for arrest of cells in G(2)/M
17210576 Claspin may be one of the phosphoproteins through which PP2A(Aalpha/Cbeta) affects Chk1 phosphorylation when ATR is activated by human immunodeficiency virus-1 Vpr.
17210576 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
17140287 In support of the idea that checkpoint activation and apoptosis induction are functionally linked, we show that Bax activation by Vpr was ablated when ATR or GADD45alpha was knocked down
17140287 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
17124492 ATM phosphorylation at Ser1981, a characterised autophosphorylation site, is ATR-dependent and ATM-independent following replication fork stalling or ultraviolet rays treatment.
17035231 in response to UV-induced DNA damage, ATR rapidly phosphorylates RPA2, disrupting its association with replication centers in the S-phase and contributing to the inhibition of DNA replication
17030982 The response of promyelocytic leukemia nuclear bodies to DNA double-strand breaks is regulated by NBS1, ATM, Chk2, and ATR.
17015476 ATR-checkpoint kinase 1-protein phosphatase 2A regulatory circuit functions to keep Chk1 in a low-activity state during an unperturbed cell division cycle
17010193 41 sequence variants, including 16 coding variants, 3 of were unreported, were found. 2 new alternative splice transcripts were found: 1 in intron 41 & 1 resulting from a deletion of 121 nucleotides in exon 33.
16968694 The role of RAS proteins in the activation of ATR and the cell cycle in thyrocytes is reported.
16956949 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
16951182 ATR/ATM-independent checkpoint response to DNA synthesis inhibition exists in HeLa cells.
16909103 ATR-dependent bystander foci induction in irradiated primary astrocytes and glioma lines is restricted to S-phase cells.
16880517 These results suggest that while TopBP1 is a general regulator of ATR, Claspin operates downstream of TopBP1 to selectively regulate the Chk1-controlled branch of the genotoxic stress response.
16827800 Alterations in the ATR gene result in an abnormal response to DNA double-strand break and single-strand break repair, suggesting a role for ATR gene alterations in NKTCL lymphomagenesis.
16757521 Herpes simplex virus type I can disrupt the usually tight colocalization of ATR and ATRIP.
16741947 ATR is one of the kinases that is likely involved in phosphorylation of Chk2 in response to ionizing radiation when ATM is deficient.
16738325 The G2/M checkpoint-mediated arrest of the cell cycle is critical for the prevention of both apoptosis and the accumulation of cells with rereplicated DNA, because the loss of ATR, BRCA1, or FANCA promotes apoptosis and suppresses the accumulation.
16705183 The activation of ATM/ATR/CHK signaling pathways contributes to this G2 checkpoint and highlight the interrelated roles of p14ARF and the Tip60 protein in the initiation of this DNA damage-signaling cascade.
16675950 Data show that ultraviolet (UV) radiation-induced ATR signaling is compromised in XPA-deficient human cells during S phase, and this signaling involves UV bypass polymerase eta.
16530042 Data show that recombinant TopBP1 induces a large increase in the kinase activity of both Xenopus and human ATR-ATRIP.
16474843 recruitment of ATR to sites of IR-induced DNA damage is concomitant with appearance of large tracts of single-stranded DNA (ssDNA) and that this event is dependent on ATM and components of the Mre11/Rad50/Nbs1 (MRN) protein complex
16461339 ATR is activated in a variety of replication-linked DNA double-strand breaks from ionizing radiation and leads to activation of checkpoints in a checkpoint kinase (Chk)1-dependent manner.
16436511 ATR was indentified as a novel mediator of telomere-dependent senescence in response to interstrand cross-link induced by photoactivated psoralens.
16431910 ATM and Mre11 may stimulate the ATR signaling pathway by converting DNA damage generated by ionizing radiation into structures that recruit and activate ATR
16354571 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
16306615 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
16260606 PP5 plays a critical role in ATR-mediated checkpoint activation
16195237 Observational study of gene-disease association. (HuGE Navigator)
16086026 regulated degradation of histone mRNAs requires regulator of nonsense transcripts 1 delta helicase, a key regulator of the nonsense-mediated decay pathway, and ATR, a key regulator of the DNA damage checkpoint pathway activated during replication stress
16009130 The ATR protein Deltap53 is an essential element of the ATR-intra-S phase checkpoint.
15987455 Observational study of gene-disease association. (HuGE Navigator)
15743907 ATRIP is required for ATR accumulation at intranuclear foci induced by DNA damage.
15734998 Both 53BP1 and NFBD1 are required for recruitment of ATR to DNA damage sites, as well as for ATR-dependent phosphorylation in response to DNA damage.
15650754 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
15650165 not required for HIV-1 derived lentivirus vector integration
15616588 Data suggest that Nijmegen breakage syndrome 1 (Nbs1) functions in both ATR- (ataxia-telangiectasia and Rad3-related protein) and ataxia telangiectasia mutated protein-dependent signalling.
15539948 Thus, optimal repair of damaged replication fork lesions likely requires both ATR and ATM. BLM recruits 53BP1 to these lesions independent of its helicase activity, and optimal activation of ATM requires both p53 and BLM helicase activities.
15533933 data reveal activated ATM and ATR exhibit selective substrate specificity in response to DNA damage
15527801 N-terminal domain of the ATRIP protein contributes to the cell cycle checkpoint by regulating the intranuclear localization of ATR
15485898 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
15466211 Effects of ATR on cell radiosensitivity are independent of NHEJ but are linked to HRR that may be affected by the deficient S and G(2) checkpoints.
15456891 Data show that Artemis interacts with cell cycle checkpoint proteins and is a phosphorylation target of the checkpoint kinases ATM or ATR after exposure of cells to IR or UV irradiation, respectively.
15374968 ATR and Chk1 play critical roles in the cellular response to hypoxia/reoxygenation in cancer cell lines, and inhibitors of ATR and Chk1 represent new hypoxic cell cytotoxins.
15314022 ATR checkpoint kinase and RPA1 are required for efficient FANCD2 monoubiquitination
15282542 ATR serves as a haploinsufficient tumor suppressor in mismatch repair-deficient cells
15279777 hSMG-1 teams with ATM and ATR to insure the overall quality of the transcriptome in human cells [review]
15235112 low-dose UV radiation activates an S-phase checkpoint requiring ATR-mediated signal transduction pathway
14988723 The transient slow-down of DNA synthesis was abolished in cells lacking ATR, whereas CHK1-siRNA-treated cells, NBS1 or Fanconi anemia cells showed partial S-phase arrest.
14755251 ATR-p53 pathway is suppressed in noncycling lymphocytes via ATR downregulation.
14742437 ATR activation is facilitated by phosphorylated H2AX stabilizing ATR at the sites of arrested replication forks
14724280 there are at least two in vitro ATR-ATRIP DNA binding complexes, one which binds DNA with high affinity in an RPA-dependent manner and a second, which binds DNA with lower affinity in an RPA-independent manner
14657349 A model in which MSH2 and ATR function upstream to regulate two branches of the response pathway to DNA damage caused by MNNG.
12959929 hyperoxia activates the ATR-Chk1 pathway and phosphorylates p53 at multiple sites in an ATM-independent manner, which is different from other forms of oxidative stress such as H2O2 or UV light.
12915485 Polyglutamine-expanded proteins strongly activated ATR.
12791985 data suggest that RPA-coated ssDNA is the critical structure at sites of DNA damage that recruits the ATR-ATRIP complex and facilitates its recognition of substrates for phosphorylation and the initiation of checkpoint signaling
12791699 the G2 checkpoint in irradiated human cells derives from an overactivation of the ATR/CHK1 pathway.
12773400 BRCA1 facilitates the ability of ATM and ATR to phosphorylate downstream substrates that directly influence cell cycle checkpoint arrest and apoptosis
12738771 ATR has a role in the DNA damage-signaling pathway by a viral gene product
12738771 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
12679521 activity of the ATR kinase is required for successful completion of the viral DNA integration process and/or survival of transduced cells
12679521 Upregulation of NKG2D ligands is dependent on HIV-1 Vpr-mediated activation of the ATR DNA damage/stress pathway, which requires the recruitment of the Cul4/DDB1/DCAF1 E3 ubiquitin ligase complex
12629512 WRN and ATR colocalize after replication fork arrest, suggesting that WRN and the ATR kinase collaborate to prevent genome instability during the S phase.
12526805 ATR has a role in regulating chromosomal fragile sites and DNA replication
12519769 ATR kinase has a critical role in the response of hypoxia and reperfusion in solid tumors.
12446774 Data suggest that the UVC-induced S checkpoint response of inhibition of replicon initiation is mediated by ATR signaling through Chk-1 and is independent of ATM, Nbs1, and Mre11.
12147700 ATR has a role in regulating cyclin B1 phosphorylation by inhibiting Plk1 kinase activity
12011431 ATR may function as an initial sensor in the DNA damage checkpoint response to UV.
11927575 lack of role in cellular response to DNA strand-scission enediyne C-1027
11865061 ATR kinase plays an important role during tumor development in responding to hypoxia-induced replication arrest, and hypoxic conditions could select for the loss of key components of ATR-dependent checkpoint controls
11721054 binds novel protein called ATRIP (ATR-interacting protein); ATRIP and ATR are mutually dependent partners in cell cycle checkpoint signaling pathways
11688760 Observational study of gene-disease association. (HuGE Navigator)
11393670 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTDSQPTSVMLLD      1 - 70
FIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLHKKICEVICSLLFLFKSKSPA     71 - 140
IFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLSQLDEHMGYLQSAPLQLMSMQNLEFIEVTLL    141 - 210
MVLTRIIAIVFFRRQELLLWQIGCVLLEYGSPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHL    211 - 280
VEMDTDQLKLYEEPLSKLIKTLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLL    281 - 350
QYFLKFVPAGYESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL    351 - 420
SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEML    421 - 490
EGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKLDLE    491 - 560
ATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFAANLLTLSCRISDSYSP    561 - 630
QAQSRCVFLLTLFPRRIFLEWRTAVYNWALQSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDS    631 - 700
DIVKKEFASILGQLVCTLHGMFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLL    701 - 770
KKKIPSPVKLAFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG    771 - 840
FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKSASVSGAAYTE    841 - 910
IRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVRKQDVAHQREMALNTLSEIAN    911 - 980
VFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQLNVNRREILINNFKYIFSHLVCSCSKDELE    981 - 1050
RALHYLKNETEIELGSLLRQDFQGLHNELLLRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMA   1051 - 1120
DYLQPKLLGILAFFNMQLLSSSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPE   1121 - 1190
LCCRAWDCFVRCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE   1191 - 1260
LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIKYATDSETVEP   1261 - 1330
IISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKDFTFVTGVEDSSFAYGLLMEL   1331 - 1400
TRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTD   1401 - 1470
WSGVKKPIYLSKLGSNFAEWSASWAGYLITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGC   1471 - 1540
NQEDQQEVYAEIMAVLKHDDQHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSN   1541 - 1610
RNKVDSMVSTVDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY   1611 - 1680
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLGLGQLS   1681 - 1750
TVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTWSVRLGQLLLSAKKRDITAFY   1751 - 1820
DSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCELEHSIKPLFQHSPGDSSQEDSLNWVARLEMT   1821 - 1890
QNSYRAKEPILALRRALLSLNKRPDYNEMVGECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERA   1891 - 1960
KWLWSKGDVHQALIVLQKGVELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTA   1961 - 2030
CLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK   2031 - 2100
AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKVFLA   2101 - 2170
YPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTDKLLELCNKPVDGSSSTLSMS   2171 - 2240
THFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIAGFDDMVEILASLQKPK   2241 - 2310
KISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWV   2311 - 2380
NNTAGLRPILTKLYKEKGVYMTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSW   2381 - 2450
YSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV   2451 - 2520
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKT   2521 - 2590
HVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM                   2591 - 2644
//

Text Mined References (356)

PMID Year Title
26940878 2016 ATR Kinase Inhibition Protects Non-cycling Cells from the Lethal Effects of DNA Damage and Transcription Stress.
26921499 2016 ATR-CHK1-E2F3 signaling transactivates human ribonucleotide reductase small subunit M2 for DNA repair induced by the chemical carcinogen MNNG.
26748709 2016 Cancer-Specific Synthetic Lethality between ATR and CHK1 Kinase Activities.
26695634 2015 STAT-5 Regulates Transcription of the Topoisomerase II?-Binding Protein 1 (TopBP1) Gene To Activate the ATR Pathway and Promote Human Papillomavirus Replication.
26667770 2015 Regulation of ATRIP protein abundance by RAD9 in the DNA damage repair pathway.
26620371 2016 A crucial role for ATR in the regulation of deoxycytidine kinase activity.
26586433 2015 ATM and ATR Signaling Regulate the Recruitment of Human Telomerase to Telomeres.
26572502 2016 ATR inhibition rewires cellular signaling networks induced by replication stress.
26567218 2015 ATM and ATR signaling at a glance.
26565033 2016 The SUMO (Small Ubiquitin-like Modifier) Ligase PIAS3 Primes ATR for Checkpoint Activation.
26563132 2016 ATR inhibition induces synthetic lethality and overcomes chemoresistance in TP53- or ATM-defective chronic lymphocytic leukemia cells.
26517239 2015 The orally active and bioavailable ATR kinase inhibitor AZD6738 potentiates the anti-tumor effects of cisplatin to resolve ATM-deficient non-small cell lung cancer in vivo.
26486089 2015 Common cancer-associated imbalances in the DNA damage response confer sensitivity to single agent ATR inhibition.
26387736 2015 ATR Plays a Direct Antiapoptotic Role at Mitochondria, which Is Regulated by Prolyl Isomerase Pin1.
26365377 2015 Distinct but Concerted Roles of ATR, DNA-PK, and Chk1 in Countering Replication Stress during S Phase.
26261078 2015 STAT3 regulated ATR via microRNA-383 to control DNA damage to affect apoptosis in A431 cells.
26168232 2015 Defining the Contribution of MC1R Physiological Ligands to ATR Phosphorylation at Ser435, a Predictor of DNA Repair in Melanocytes.
26124337 2015 Ataxia-Telangiectasia and RAD3-Related and Ataxia-Telangiectasia-Mutated Proteins in Epithelial Ovarian Carcinoma: Their Expression and Clinical Significance.
26061708 2015 rRNA synthesis inhibitor, CX-5461, activates ATM/ATR pathway in acute lymphoblastic leukemia, arrests cells in G2 phase and induces apoptosis.
26061604 2015 Mangrove dolabrane-type of diterpenes tagalsins suppresses tumor growth via ROS-mediated apoptosis and ATM/ATR-Chk1/Chk2-regulated cell cycle arrest.
25980679 2015 A novel role of the checkpoint kinase ATR in leptin signaling.
25966274 2015 Mangiferin induces cell cycle arrest at G2/M phase through ATR-Chk1 pathway in HL-60 leukemia cells.
25962492 2015 SHP-1 overexpression increases the radioresistance of NPC cells by enhancing DSB repair, increasing S phase arrest and decreasing cell apoptosis.
25916852 2015 High levels of TopBP1 induce ATR-dependent shut-down of rRNA transcription and nucleolar segregation.
25911100 2015 Genome Protection by the 9-1-1 Complex Subunit HUS1 Requires Clamp Formation, DNA Contacts, and ATR Signaling-independent Effector Functions.
25904336 2015 ATR and a Chk1-Aurora B pathway coordinate postmitotic genome surveillance with cytokinetic abscission.
25846551 2015 Profiling cancer gene mutations in longitudinal epithelial ovarian cancer biopsies by targeted next-generation sequencing: a retrospective study.
25843623 2015 ATR-mediated phosphorylation of FANCI regulates dormant origin firing in response to replication stress.
25812484 2015 Resveratrol analogue (E)-8-acetoxy-2-[2-(3,4-diacetoxyphenyl)ethenyl]-quinazoline induces G?/M cell cycle arrest through the activation of ATM/ATR in human cervical carcinoma HeLa cells.
25757065 2015 Aven-mediated checkpoint kinase control regulates proliferation and resistance to chemotherapy in conventional osteosarcoma.
25748550 2015 Trovafloxacin-induced replication stress sensitizes HepG2 cells to tumor necrosis factor-alpha-induced cytotoxicity mediated by extracellular signal-regulated kinase and ataxia telangiectasia and Rad3-related.
25694603 2015 Viral DNA replication-dependent DNA damage response activation during BK polyomavirus infection.
25497328 2015 The complexity of DNA double strand break is a crucial factor for activating ATR signaling pathway for G2/M checkpoint regulation regardless of ATM function.
25483091 2014 Depletion of ATR selectively sensitizes ATM-deficient human mammary epithelial cells to ionizing radiation and DNA-damaging agents.
25468710 2015 Untangling the ATR-CHEK1 network for prognostication, prediction and therapeutic target validation in breast cancer.
25459351 2015 Development of pharmacodynamic biomarkers for ATR inhibitors.
25397632 2015 Fe65 Ser228 is phosphorylated by ATM/ATR and inhibits Fe65-APP-mediated gene transcription.
25380827 2015 ATR suppresses apoptosis after UVB irradiation by controlling both translesion synthesis and alternative tolerance pathways.
25336189 2014 Identification of ATR-Chk1 pathway inhibitors that selectively target p53-deficient cells without directly suppressing ATR catalytic activity.
25301947 2014 Phosphorylation of the BRCA1 C terminus (BRCT) repeat inhibitor of hTERT (BRIT1) protein coordinates TopBP1 protein recruitment and amplifies ataxia telangiectasia-mutated and Rad3-related (ATR) Signaling.
25288669 2015 DNA double-strand breaks by Cr(VI) are targeted to euchromatin and cause ATR-dependent phosphorylation of histone H2AX and its ubiquitination.
25269479 2014 ATR inhibitors VE-821 and VX-970 sensitize cancer cells to topoisomerase i inhibitors by disabling DNA replication initiation and fork elongation responses.
25232030 2015 A synthetic lethal screen reveals enhanced sensitivity to ATR inhibitor treatment in mantle cell lymphoma with ATM loss-of-function.
25083873 2014 ATR mediates a checkpoint at the nuclear envelope in response to mechanical stress.
24971543 2014 v-Src inhibits the interaction between Rad17 and Rad9 and induces replication fork collapse.
24950377 2014 PKA-mediated phosphorylation of ATR promotes recruitment of XPA to UV-induced DNA damage.
24901225 2014 Mutation of serine 1333 in the ATR HEAT repeats creates a hyperactive kinase.
24799566 2014 Simian virus 40 large T antigen induces IFN-stimulated genes through ATR kinase.
24752797 2014 Development of serous ovarian cancer is associated with the expression of homologous recombination pathway proteins.
24726882 2014 Induction of ATM/ATR pathway combined with V?2V?2 T cells enhances cytotoxicity of ovarian cancer cells.
24700029 2014 ATR checkpoint kinase and CRL1?TRCP collaborate to degrade ASF1a and thus repress genes overlapping with clusters of stalled replication forks.
24682951 2014 Most hydrogen peroxide-induced histone H2AX phosphorylation is mediated by ATR and is not dependent on DNA double-strand breaks.
24672057 2014 Nedd8-activating enzyme inhibitor MLN4924 provides synergy with mitomycin C through interactions with ATR, BRCA1/BRCA2, and chromatin dynamics pathways.
24662920 2014 ATR pathway inhibition is synthetically lethal in cancer cells with ERCC1 deficiency.
24639502 2014 STAT3 interrupts ATR-Chk1 signaling to allow oncovirus-mediated cell proliferation.
24634213 2014 Src family kinases promote silencing of ATR-Chk1 signaling in termination of DNA damage checkpoint.
24327542 2014 Targeted inhibition of ATR or CHEK1 reverses radioresistance in oral squamous cell carcinoma cells with distal chromosome arm 11q loss.
24267891 2013 ATR prohibits replication catastrophe by preventing global exhaustion of RPA.
24238855 2013 Investigation of switch from ATM to ATR signaling at the sites of DNA damage induced by low and high LET radiation.
24098119 2013 Herpes simplex virus type 1 single strand DNA binding protein and helicase/primase complex disable cellular ATR signaling.
24045107 2013 The human immunodeficiency virus type 1 Vpr protein upregulates PVR via activation of the ATR-mediated DNA damage response pathway.
24005565 2013 Human DNA helicase HELQ participates in DNA interstrand crosslink tolerance with ATR and RAD51 paralogs.
23897887 2013 DNA structure-specific priming of ATR activation by DNA-PKcs.
23874235 2013 Stepwise activation of the ATR signaling pathway upon increasing replication stress impacts fragile site integrity.
23873943 2013 ATR phosphorylates SMARCAL1 to prevent replication fork collapse.
23861882 2013 UV-induced nuclear import of XPA is mediated by importin-?4 in an ATR-dependent manner.
23844225 2013 Associations of ATR and CHEK1 single nucleotide polymorphisms with breast cancer.
23813879 2014 ATR controls the UV-related upregulation of the CDKN1A mRNA in a Cdk1/HuR-dependent manner.
23807228 2013 Repression of ATR pathway by miR-185 enhances radiation-induced apoptosis and proliferation inhibition.
23733185 2013 4-Hydroxynonenal induces G2/M phase cell cycle arrest by activation of the ataxia telangiectasia mutated and Rad3-related protein (ATR)/checkpoint kinase 1 (Chk1) signaling pathway.
23698467 2013 ATR-dependent phosphorylation of FANCM at serine 1045 is essential for FANCM functions.
23696651 2013 Direct role for the replication protein treslin (Ticrr) in the ATR kinase-mediated checkpoint response.
23684611 2013 Two distinct modes of ATR activation orchestrated by Rad17 and Nbs1.
23600770 2013 HY-1 induces G(2)/M cell cycle arrest in human colon cancer cells through the ATR-Chk1-Cdc25C and Weel pathways.
23592994 2013 ATM and ATR activities maintain replication fork integrity during SV40 chromatin replication.
23592782 2013 Ataxia telangiectasia-mutated- and Rad3-related protein regulates the DNA damage-induced G2/M checkpoint through the Aurora A cofactor Bora protein.
23548269 2013 ATR inhibition broadly sensitizes ovarian cancer cells to chemotherapy independent of BRCA status.
23454212 2013 HIF1-regulated ATRIP expression is required for hypoxia induced ATR activation.
23451157 2013 Ataxia telangiectasia mutated and Rad3 related (ATR) protein kinase inhibition is synthetically lethal in XRCC1 deficient ovarian cancer cells.
23447702 2013 The nucleolus stress response is coupled to an ATR-Chk1-mediated G2 arrest.
23447674 2013 UV-induced G2 checkpoint depends on p38 MAPK and minimal activation of ATR-Chk1 pathway.
23438602 2013 ATM- and ATR-mediated phosphorylation of XRCC3 regulates DNA double-strand break-induced checkpoint activation and repair.
23401567 2013 Small molecule inhibition of p38 MAP kinase extends the replicative life span of human ATR-Seckel syndrome fibroblasts.
23345434 2013 Nek1 kinase associates with ATR-ATRIP and primes ATR for efficient DNA damage signaling.
23284306 2012 A synthetic interaction screen identifies factors selectively required for proliferation and TERT transcription in p53-deficient human cancer cells.
23272087 2012 Inactivation of ATM/ATR DNA damage checkpoint promotes androgen induced chromosomal instability in prostate epithelial cells.
23255133 2013 Separation of intra-S checkpoint protein contributions to DNA replication fork protection and genomic stability in normal human fibroblasts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178497 2014 Coordinated regulation of XPA stability by ATR and HERC2 during nucleotide excision repair.
23176708 2012 An S/T-Q cluster domain census unveils new putative targets under Tel1/Mec1 control.
23144622 2012 Identification of the first ATRIP-deficient patient and novel mutations in ATR define a clinical spectrum for ATR-ATRIP Seckel Syndrome.
23135710 2013 Engagement of the ATR-dependent DNA damage response at the human papillomavirus 18 replication centers during the initial amplification.
23085754 2013 ATR controls cellular adaptation to hypoxia through positive regulation of hypoxia-inducible factor 1 (HIF-1) expression.
23029527 2012 Checkpoint kinase ATR phosphorylates Cdt2, a substrate receptor of CRL4 ubiquitin ligase, and promotes the degradation of Cdt1 following UV irradiation.
22952448 2012 Roles of ATM and ATR-mediated DNA damage responses during lytic BK polyomavirus infection.
22948311 2012 In vitro analysis of the role of replication protein A (RPA) and RPA phosphorylation in ATR-mediated checkpoint signaling.
22842784 2012 ATM/ATR checkpoint activation downregulates CDC25C to prevent mitotic entry with uncapped telomeres.
22807682 2012 HPV 5 and 8 E6 abrogate ATR activity resulting in increased persistence of UVB induced DNA damage.
22797063 2013 DNA-PK, ATM and ATR collaboratively regulate p53-RPA interaction to facilitate homologous recombination DNA repair.
22740051 2012 The Wnt inhibitor secreted Frizzled-Related Protein 1 (sFRP1) promotes human Th17 differentiation.
22735644 2012 DBC1 phosphorylation by ATM/ATR inhibits SIRT1 deacetylase in response to DNA damage.
22713662 2012 Targeting radiation-resistant hypoxic tumour cells through ATR inhibition.
22621920 2012 ATP depletion triggers acute myeloid leukemia differentiation through an ATR/Chk1 protein-dependent and p53 protein-independent pathway.
22556425 2012 Hypoxia activates tumor suppressor p53 by inducing ATR-Chk1 kinase cascade-mediated phosphorylation and consequent 14-3-3? inactivation of MDMX protein.
22535492 2012 Stromal factors SDF1?, sFRP1, and VEGFD induce dopaminergic neuron differentiation of human pluripotent stem cells.
22435685 2012 Novel regulation of checkpoint kinase 1: Is checkpoint kinase 1 a good candidate for anti-cancer therapy?
22341969 2012 Germline mutation in ATR in autosomal- dominant oropharyngeal cancer syndrome.
22179839 2012 Hypoxic activation of ATR and the suppression of the initiation of DNA replication through cdc6 degradation.
22174788 2011 XPA-mediated regulation of global nucleotide excision repair by ATR Is p53-dependent and occurs primarily in S-phase.
22159421 2011 WRN helicase regulates the ATR-CHK1-induced S-phase checkpoint pathway in response to topoisomerase-I-DNA covalent complexes.
22123827 2012 Dbf4 is direct downstream target of ataxia telangiectasia mutated (ATM) and ataxia telangiectasia and Rad3-related (ATR) protein to regulate intra-S-phase checkpoint.
22084169 2012 Targeted mutations in the ATR pathway define agent-specific requirements for cancer cell growth and survival.
21998596 2011 CtIP Mutations Cause Seckel and Jawad Syndromes.
21995812 2011 Differential roles for Chk1 and FANCD2 in ATR-mediated signalling for psoralen photoactivation-induced senescence.
21976111 2012 ATR controls the p21(WAF1/Cip1) protein up-regulation and apoptosis in response to low UV fluences.
21908846 2011 Analysis of mutations that dissociate G(2) and essential S phase functions of human ataxia telangiectasia-mutated and Rad3-related (ATR) protein kinase.
21859891 2011 BID binds to replication protein A and stimulates ATR function following replicative stress.
21857991 2011 ATR-p53 restricts homologous recombination in response to replicative stress but does not limit DNA interstrand crosslink repair in lung cancer cells.
21829167 2011 Human UPF1 interacts with TPP1 and telomerase and sustains telomere leading-strand replication.
21705319 2011 Thr-1989 phosphorylation is a marker of active ataxia telangiectasia-mutated and Rad3-related (ATR) kinase.
21680529 2011 Parvovirus B19 infection of human primary erythroid progenitor cells triggers ATR-Chk1 signaling, which promotes B19 virus replication.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
21566061 2011 Hsp90 inhibitor-mediated disruption of chaperone association of ATR with hsp90 sensitizes cancer cells to DNA damage.
21502314 2011 Tethering DNA damage checkpoint mediator proteins topoisomerase IIbeta-binding protein 1 (TopBP1) and Claspin to DNA activates ataxia-telangiectasia mutated and RAD3-related (ATR) phosphorylation of checkpoint kinase 1 (Chk1).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21383502 2011 Genomic DNA damage and ATR-Chk1 signaling determine oncolytic adenoviral efficacy in human ovarian cancer cells.
21308861 2011 Inhibition of ataxia telangiectasia- and Rad3-related function abrogates the in vitro and in vivo tumorigenicity of human colon cancer cells through depletion of the CD133(+) tumor-initiating cell fraction.
21294646 2011 Ataxia telangiectasia and Rad3-related overexpressing cancer cells induce prolonged G? arrest and develop resistance to ionizing radiation.
21285353 2011 hMSH2 recruits ATR to DNA damage sites for activation during DNA damage-induced apoptosis.
21284603 2011 ATR (ataxia telangiectasia mutated- and Rad3-related kinase) is activated by mild hypothermia in mammalian cells and subsequently activates p53.
21270107 2011 The atr protein kinase controls UV-dependent upregulation of p16INK4A through inhibition of Skp2-related polyubiquitination/degradation.
21269460 2011 Initial characterization of the human central proteome.
21242293 2011 ATR-mediated phosphorylation of DNA polymerase ? is needed for efficient recovery from UV damage.
21224401 2011 UV-induced photolesions elicit ATR-kinase-dependent signaling in non-cycling cells through nucleotide excision repair-dependent and -independent pathways.
21144835 2011 Protein phosphatase 5 is necessary for ATR-mediated DNA repair.
21034966 2010 The ATM-Chk2 and ATR-Chk1 pathways in DNA damage signaling and cancer.
20930849 2010 Cyclin-dependent kinase 9-cyclin K functions in the replication stress response.
20864032 2010 CK2 phospho-dependent binding of R2TP complex to TEL2 is essential for mTOR and SMG1 stability.
20861269 2010 ATR and ATRIP are recruited to herpes simplex virus type 1 replication compartments even though ATR signaling is disabled.
20818375 2010 Phosphorylation of MLL by ATR is required for execution of mammalian S-phase checkpoint.
20810650 2010 A genetic screen identifies the Triple T complex required for DNA damage signaling and ATM and ATR stability.
20801936 2010 Tel2 structure and function in the Hsp90-dependent maturation of mTOR and ATR complexes.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20616048 2010 Reconstitution of RPA-covered single-stranded DNA-activated ATR-Chk1 signaling.
20566845 2010 Adenovirus 12 E4orf6 inhibits ATR activation by promoting TOPBP1 degradation.
20515729 2010 Mechanisms of ATR-mediated checkpoint signalling.
20513533 2010 Interaction between BRCA1/BRCA2 and ATM/ATR associate with breast cancer susceptibility in a Chinese Han population.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20469721 [Phosphorylation of ATM/ATR substrates in eukaryotic cells after infection with Helicobacter pylori].
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20427287 2010 Tti1 and Tel2 are critical factors in mammalian target of rapamycin complex assembly.
20368801 2010 Dynamic dependence on ATR and ATM for double-strand break repair in human embryonic stem cells and neural descendants.
20233725 2010 Tipin-replication protein A interaction mediates Chk1 phosphorylation by ATR in response to genotoxic stress.
20147462 2010 ATR contributes to telomere maintenance in human cells.
20103595 2010 Functional significance for a heterogenous ribonucleoprotein A18 signature RNA motif in the 3'-untranslated region of ataxia telangiectasia mutated and Rad3-related (ATR) transcript.
20084458 2010 Compromise in mRNA processing machinery in senescent human fibroblasts: implications for a novel potential role of Phospho-ATR (ser428).
20060399 2010 ATR preferentially interacts with common fragile site FRA3B and the binding requires its kinase activity in response to aphidicolin treatment.
20048340 2010 CDC6 interaction with ATR regulates activation of a replication checkpoint in higher eukaryotic cells.
20029092 2010 Interactions of human mismatch repair proteins MutSalpha and MutLalpha with proteins of the ATR-Chk1 pathway.
19903823 2010 Large T antigen promotes JC virus replication in G2-arrested cells by inducing ATM- and ATR-mediated G2 checkpoint signaling.
19828454 2009 Reconstitution of human claspin-mediated phosphorylation of Chk1 by the ATR (ataxia telangiectasia-mutated and rad3-related) checkpoint kinase.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19633697 2009 Cdc5L interacts with ATR and is required for the S-phase cell-cycle checkpoint.
19586908 2009 Checkpoint kinase ATR promotes nucleotide excision repair of UV-induced DNA damage via physical interaction with xeroderma pigmentosum group A.
19584262 2009 Cyclooxygenase-2 up-regulates ataxia telangiectasia and Rad3 related through extracellular signal-regulated kinase activation.
19570909 2009 Reduced ATR or Chk1 expression leads to chromosome instability and chemosensitization of mismatch repair-deficient colorectal cancer cells.
19536649 2009 The Fanconi anemia family of genes and its correlation with breast cancer susceptibility and breast cancer features.
19527713 2009 Bleomycin-induced over-replication involves sustained inhibition of mitotic entry through the ATM/ATR pathway.
19477925 2009 Estrogen inhibits ATR signaling to cell cycle checkpoints and DNA repair.
19470935 2009 ATR mutation in endometrioid endometrial cancer is associated with poor clinical outcomes.
19444312 2009 Distinct roles of ATR and DNA-PKcs in triggering DNA damage responses in ATM-deficient cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19372558 2009 Ataxia telangiectasia and rad3-related kinase contributes to cell cycle arrest and survival after cisplatin but not oxaliplatin.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19285939 2009 Single-stranded DNA orchestrates an ATM-to-ATR switch at DNA breaks.
19244116 2009 Inactivation of the Nijmegen breakage syndrome gene leads to excess centrosome duplication via the ATR/BRCA1 pathway.
19242509 2009 ATR-Chk1 pathway inhibition promotes apoptosis after UV treatment in primary human keratinocytes: potential basis for the UV protective effects of caffeine.
19197236 2009 Mislocalization of the MRN complex prevents ATR signaling during adenovirus infection.
19154794 2009 ATR (AT mutated Rad3 related) activity stabilizes Cdc6 and delays G2/M-phase entry during hydroxyurea-induced S-phase arrest of HeLa cells.
19146767 2009 ATR, BRCA1 and gammaH2AX localize to unsynapsed chromosomes at the pachytene stage in human oocytes.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19119425 2009 ATR and Chk1 suppress a caspase-3-dependent apoptotic response following DNA replication stress.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19109555 2009 ATR-dependent phosphorylation of FANCA on serine 1449 after DNA damage is important for FA pathway function.
19097996 2009 HCLK2 is required for activity of the DNA damage response kinase ATR.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064565 2008 Common single-nucleotide polymorphisms in DNA double-strand break repair genes and breast cancer risk.
19004803 2008 ATR kinase is required for global genomic nucleotide excision repair exclusively during S phase in human cells.
18985806 2008 Ataxia telangiectasia-mutated-Rad3-related DNA damage checkpoint signaling pathway triggered by hepatitis B virus infection.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18936170 2008 The basic cleft of RPA70N binds multiple checkpoint proteins, including RAD9, to regulate ATR signaling.
18931676 2008 FANCI phosphorylation functions as a molecular switch to turn on the Fanconi anemia pathway.
18757420 2008 ATM acts downstream of ATR in the DNA damage response signaling of bystander cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18664457 2008 Replication independent ATR signalling leads to G2/M arrest requiring Nbs1, 53BP1 and MDC1.
18642075 2009 Promoter methylation patterns of ATM, ATR, BRCA1, BRCA2 and p53 as putative cancer risk modifiers in Jewish BRCA1/BRCA2 mutation carriers.
18625709 2008 ATR-dependent activation of p38 MAP kinase is responsible for apoptotic cell death in cells depleted of Cdc7.
18583959 2008 Induction of a pro-apoptotic ATM-NF-kappaB pathway and its repression by ATR in response to replication stress.
18550533 2008 Cleavage-mediated activation of Chk1 during apoptosis.
18536714 2008 Control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR.
18519640 2008 TopBP1 activates ATR through ATRIP and a PIKK regulatory domain.
18495871 2008 An essential role for MCL-1 in ATR-mediated CHK1 phosphorylation.
18480045 2008 Differential roles for checkpoint kinases in DNA damage-dependent degradation of the Cdc25A protein phosphatase.
18451257 2008 Tagging single nucleotide polymorphisms in phosphoinositide-3-kinase-related protein kinase genes involved in DNA damage "checkpoints" and lung cancer susceptibility.
18451105 2008 Chk1 and Claspin potentiate PCNA ubiquitination.
18434539 2008 DNA synthesis from unbalanced nucleotide pools causes limited DNA damage that triggers ATR-CHK1-dependent p53 activation.
18381943 2008 Single-nucleotide polymorphisms of DNA damage response genes are associated with overall survival in patients with pancreatic cancer.
18357388 2008 ATR alterations in Hodgkin's lymphoma.
18283122 2008 Cep164 is a mediator protein required for the maintenance of genomic stability through modulation of MDC1, RPA, and CHK1.
18245444 2008 ATR signaling can drive cells into senescence in the absence of DNA breaks.
18202016 2008 Ataxia-telangiectasia and Rad3-related and DNA-dependent protein kinase cooperate in G2 checkpoint activation by the DNA strand-breaking nucleoside analogue 2'-C-cyano-2'-deoxy-1-beta-D-arabino-pentofuranosylcytosine.
18162465 2008 ATR-Chk2 signaling in p53 activation and DNA damage response during cisplatin-induced apoptosis.
18032786 2007 The increase of cell-membranous phosphatidylcholines containing polyunsaturated fatty acid residues induces phosphorylation of p53 through activation of ATR.
18025301 2007 The ATR-mediated S phase checkpoint prevents rereplication in mammalian cells when licensing control is disrupted.
18003706 2007 NBS1 mediates ATR-dependent RPA hyperphosphorylation following replication-fork stall and collapse.
17976513 2007 Inhibition of cellular proliferation by the genistein metabolite 5,7,3',4'-tetrahydroxyisoflavone is mediated by DNA damage and activation of the ATR signalling pathway.
17934520 2008 Interplay between ATM and ATR in the regulation of common fragile site stability.
17879369 2007 Mutations in the ataxia telangiectasia and rad3-related-checkpoint kinase 1 DNA damage response axis in colon cancers.
17716975 2007 ATR pathway is the primary pathway for activating G2/M checkpoint induction after re-replication.
17686975 2007 Reconstitution of a human ATR-mediated checkpoint response to damaged DNA.
17638878 2007 Cyclin-dependent kinase 2 dependent phosphorylation of ATRIP regulates the G2-M checkpoint response to DNA damage.
17616665 2007 Phosphorylation of ATR-interacting protein on Ser239 mediates an interaction with breast-ovarian cancer susceptibility 1 and checkpoint function.
17616578 2007 RPA and ATR link transcriptional stress to p53.
17526493 2007 The Mre11-Rad50-Nbs1 complex acts both upstream and downstream of ataxia telangiectasia mutated and Rad3-related protein (ATR) to regulate the S-phase checkpoint following UV treatment.
17478428 2007 A proteomic analysis of ataxia telangiectasia-mutated (ATM)/ATM-Rad3-related (ATR) substrates identifies the ubiquitin-proteasome system as a regulator for DNA damage checkpoints.
17409144 2007 The ATM/ATR signaling effector Chk2 is targeted by Epstein-Barr virus nuclear antigen 3C to release the G2/M cell cycle block.
17384681 2007 Identification of a PP2A-interacting protein that functions as a negative regulator of phosphatase activity in the ATM/ATR signaling pathway.
17376433 2007 Function of the ATR N-terminal domain revealed by an ATM/ATR chimera.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17292679 2007 ATR signaling mediates an S-phase checkpoint after inhibition of poly(ADP-ribose) polymerase activity.
17210576 2007 Phosphatase type 2A-dependent and -independent pathways for ATR phosphorylation of Chk1.
17157788 2006 Che-1 phosphorylation by ATM/ATR and Chk2 kinases activates p53 transcription and the G2/M checkpoint.
17140287 2006 HIV-1 Vpr-induced apoptosis is cell cycle dependent and requires Bax but not ANT.
17124492 2006 ATR-dependent phosphorylation and activation of ATM in response to UV treatment or replication fork stalling.
17035231 2006 RPA2 is a direct downstream target for ATR to regulate the S-phase checkpoint.
17030982 2006 Promyelocytic leukemia nuclear bodies behave as DNA damage sensors whose response to DNA double-strand breaks is regulated by NBS1 and the kinases ATM, Chk2, and ATR.
17015476 2006 Phosphorylation of Chk1 by ATR is antagonized by a Chk1-regulated protein phosphatase 2A circuit.
17010193 2006 Mutation analysis and characterization of ATR sequence variants in breast cancer cases from high-risk French Canadian breast/ovarian cancer families.
16968694 2006 Ras triggers ataxia-telangiectasia-mutated and Rad-3-related activation and apoptosis through sustained mitogenic signaling.
16951182 2006 Chk1- and claspin-dependent but ATR/ATM- and Rad17-independent DNA replication checkpoint response in HeLa cells.
16943440 2006 Phosphorylation of FANCD2 on two novel sites is required for mitomycin C resistance.
16909103 2007 ATR-dependent radiation-induced gamma H2AX foci in bystander primary human astrocytes and glioma cells.
16880517 2006 Claspin operates downstream of TopBP1 to direct ATR signaling towards Chk1 activation.
16827800 2006 Alterations in ATR in nasal NK/T-cell lymphoma and chronic active Epstein-Barr virus infection.
16757521 2006 Herpes simplex virus type I disrupts the ATR-dependent DNA-damage response during lytic infection.
16741947 2006 ATR dependent activation of Chk2.
16738325 2006 An ATR- and BRCA1-mediated Fanconi anemia pathway is required for activating the G2/M checkpoint and DNA damage repair upon rereplication.
16713580 2006 ATR kinase activation mediated by MutSalpha and MutLalpha in response to cytotoxic O6-methylguanine adducts.
16705183 2006 p14ARF activates a Tip60-dependent and p53-independent ATM/ATR/CHK pathway in response to genotoxic stress.
16675950 2006 Opposing effects of the UV lesion repair protein XPA and UV bypass polymerase eta on ATR checkpoint signaling.
16540648 2006 Phosphorylation of nucleotide excision repair factor xeroderma pigmentosum group A by ataxia telangiectasia mutated and Rad3-related-dependent checkpoint pathway promotes cell survival in response to UV irradiation.
16530042 2006 TopBP1 activates the ATR-ATRIP complex.
16474843 2006 Recruitment of ATR to sites of ionising radiation-induced DNA damage requires ATM and components of the MRN protein complex.
16461339 2006 ATM regulates ATR chromatin loading in response to DNA double-strand breaks.
16436511 2006 Senescence of human fibroblasts after psoralen photoactivation is mediated by ATR kinase and persistent DNA damage foci at telomeres.
16431910 2006 Rapid activation of ATR by ionizing radiation requires ATM and Mre11.
16293623 2006 DNA replication stress-induced phosphorylation of cyclic AMP response element-binding protein mediated by ATM.
16260606 2005 Protein phosphatase 5 is required for ATR-mediated checkpoint activation.
16195237 2006 Polymorphisms of DNA repair genes and risk of non-small cell lung cancer.
16086026 2005 Regulated degradation of replication-dependent histone mRNAs requires both ATR and Upf1.
16009130 2005 A novel human p53 isoform is an essential element of the ATR-intra-S phase checkpoint.
15987455 2005 Mutation analysis of the ATR gene in breast and ovarian cancer families.
15854902 2005 Rheb binds and regulates the mTOR kinase.
15758953 2005 Conserved modes of recruitment of ATM, ATR and DNA-PKcs to sites of DNA damage.
15743907 2005 ATRIP binding to replication protein A-single-stranded DNA promotes ATR-ATRIP localization but is dispensable for Chk1 phosphorylation.
15734998 2005 NFBD1/Mdc1 mediates ATR-dependent DNA damage response.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15680327 2005 The haploinsufficient tumor suppressor p18 upregulates p53 via interactions with ATM/ATR.
15650165 2005 The ataxia telangiectasia-mutated and Rad3-related protein is dispensable for retroviral integration.
15635413 2005 Nucleolar proteome dynamics.
15616588 2005 Nbs1 is required for ATR-dependent phosphorylation events.
15539948 2004 ATR and ATM-dependent movement of BLM helicase during replication stress ensures optimal ATM activation and 53BP1 focus formation.
15538388 2004 Interaction between human MCM7 and Rad17 proteins is required for replication checkpoint signaling.
15533933 2005 Ataxia telangiectasia mutated (ATM) and ATM and Rad3-related protein exhibit selective target specificities in response to different forms of DNA damage.
15527801 2004 Amino-terminal domain of ATRIP contributes to intranuclear relocation of the ATR-ATRIP complex following DNA damage.
15496423 2004 Seckel syndrome exhibits cellular features demonstrating defects in the ATR-signalling pathway.
15466211 2004 ATR affecting cell radiosensitivity is dependent on homologous recombination repair but independent of nonhomologous end joining.
15456891 2004 Artemis is a phosphorylation target of ATM and ATR and is involved in the G2/M DNA damage checkpoint response.
15451423 2004 ATR-dependent phosphorylation of ATRIP in response to genotoxic stress.
15374968 2004 Inhibition of ATR leads to increased sensitivity to hypoxia/reoxygenation.
15314022 2004 ATR couples FANCD2 monoubiquitination to the DNA-damage response.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15282542 2004 ATR functions as a gene dosage-dependent tumor suppressor on a mismatch repair-deficient background.
15279777 The ATM-related kinase, hSMG-1, bridges genome and RNA surveillance pathways.
15235112 2004 Chromatin association of rad17 is required for an ataxia telangiectasia and rad-related kinase-mediated S-phase checkpoint in response to low-dose ultraviolet radiation.
15210935 2004 Minichromosome maintenance proteins are direct targets of the ATM and ATR checkpoint kinases.
15149599 2004 Telomere shortening triggers senescence of human cells through a pathway involving ATM, p53, and p21(CIP1), but not p16(INK4a).
15050919 2004 BCR/ABL translocates to the nucleus and disrupts an ATR-dependent intra-S phase checkpoint.
14988723 2004 The DNA crosslink-induced S-phase checkpoint depends on ATR-CHK1 and ATR-NBS1-FANCD2 pathways.
14871897 2004 Recruitment of the cell cycle checkpoint kinase ATR to chromatin during S-phase.
14755251 2004 The ATR-p53 pathway is suppressed in noncycling normal and malignant lymphocytes.
14742437 2004 UV-induced ataxia-telangiectasia-mutated and Rad3-related (ATR) activation requires replication stress.
14729973 2004 Quaternary structure of ATR and effects of ATRIP and replication protein A on its DNA binding and kinase activities.
14724280 2004 A novel protein activity mediates DNA binding of an ATR-ATRIP complex.
14657349 2003 MSH2 and ATR form a signaling module and regulate two branches of the damage response to DNA methylation.
12959929 2004 Hyperoxia activates the ATR-Chk1 pathway and phosphorylates p53 at multiple sites.
12915485 2003 DNA damage induced by polyglutamine-expanded proteins.
12814551 2003 ATR kinase activity regulates the intranuclear translocation of ATR and RPA following ionizing radiation.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12791699 2003 An overactivated ATR/CHK1 pathway is responsible for the prolonged G2 accumulation in irradiated AT cells.
12773400 2003 A subset of ATM- and ATR-dependent phosphorylation events requires the BRCA1 protein.
12766152 2003 Human claspin is required for replication checkpoint control.
12738771 2003 Activation of the ATR-mediated DNA damage response by the HIV-1 viral protein R.
12679521 2003 Evidence that the retroviral DNA integration process triggers an ATR-dependent DNA damage response.
12640452 2003 A splicing mutation affecting expression of ataxia-telangiectasia and Rad3-related protein (ATR) results in Seckel syndrome.
12629512 2003 Werner's syndrome protein is phosphorylated in an ATR/ATM-dependent manner following replication arrest and DNA damage induced during the S phase of the cell cycle.
12526805 2002 ATR regulates fragile site stability.
12519769 2003 ATR/ATM targets are phosphorylated by ATR in response to hypoxia and ATM in response to reoxygenation.
12493754 2003 Polo-like kinase 1 and Chk2 interact and co-localize to centrosomes and the midbody.
12446774 2002 An ATR- and Chk1-dependent S checkpoint inhibits replicon initiation following UVC-induced DNA damage.
12147700 2002 ATR enforces the topoisomerase II-dependent G2 checkpoint through inhibition of Plk1 kinase.
12024051 2002 Chk2 activation and phosphorylation-dependent oligomerization.
12011431 2002 Preferential binding of ATR protein to UV-damaged DNA.
11927575 2002 Cellular responses to the DNA strand-scission enediyne C-1027 can be independent of ATM, ATR, and DNA-PK kinases.
11883897 2002 Kinetic properties of p53 phosphorylation by the human vaccinia-related kinase 1.
11865061 2002 Hypoxia links ATR and p53 through replication arrest.
11799063 2002 Regulation of ATR substrate selection by Rad17-dependent loading of Rad9 complexes onto chromatin.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11721054 2001 ATR and ATRIP: partners in checkpoint signaling.
11715017 2001 Mrc1 channels the DNA replication arrest signal to checkpoint kinase Cds1.
11709713 2001 UV-radiation induces dose-dependent regulation of p53 response and modulates p53-HDM2 interaction in human fibroblasts.
11688760 2001 Lack of association of the renin-angiotensin system genes polymorphisms and left ventricular hypertrophy in hypertension.
11673449 2001 Histone H2AX is phosphorylated in an ATR-dependent manner in response to replicational stress.
11551930 2001 Plk3 functionally links DNA damage to cell cycle arrest and apoptosis at least in part via the p53 pathway.
11470508 2001 Evidence for alternate splicing within the mRNA transcript encoding the DNA damage response kinase ATR.
11459832 2001 Selective induction of E2F1 in response to DNA damage, mediated by ATM-dependent phosphorylation.
11418864 2001 ATR/ATM-mediated phosphorylation of human Rad17 is required for genotoxic stress responses.
11393670 2001 Homozygosity for angiotensinogen 235T variant increases the risk of myocardial infarction in patients with multi-vessel coronary artery disease.
11390642 2001 ATR-mediated checkpoint pathways regulate phosphorylation and activation of human Chk1.
11252893 2000 The many substrates and functions of ATM.
11163154 2001 ATM and ATR: networking cellular responses to DNA damage.
11114888 2000 Functional interactions between BRCA1 and the checkpoint kinase ATR during genotoxic stress.
10973490 2000 Ataxia telangiectasia-mutated phosphorylates Chk2 in vivo and in vitro.
10951572 2000 The human vaccinia-related kinase 1 (VRK1) phosphorylates threonine-18 within the mdm-2 binding site of the p53 tumour suppressor protein.
10889046 2000 Autozygosity mapping of a seckel syndrome locus to chromosome 3q22. 1-q24.
10859164 2000 Chk1 is an essential kinase that is regulated by Atr and required for the G(2)/M DNA damage checkpoint.
10749680 2000 The Shc-related adaptor protein, Sck, forms a complex with the vascular-endothelial-growth-factor receptor KDR in transfected cells.
10747897 2000 Stress-induced activation of protein kinase CK2 by direct interaction with p38 mitogen-activated protein kinase.
10673501 2000 The human homologs of checkpoint kinases Chk1 and Cds1 (Chk2) phosphorylate p53 at multiple DNA damage-inducible sites.
10608806 1999 Substrate specificities and identification of putative substrates of ATM kinase family members.
10597277 1999 ATR is a caffeine-sensitive, DNA-activated protein kinase with a substrate specificity distinct from DNA-PK.
10545197 1999 Molecular association between ATR and two components of the nucleosome remodeling and deacetylating complex, HDAC2 and CHD4.
9925639 1999 A role for ATR in the DNA damage-induced phosphorylation of p53.
9857181 1998 Analysis of Rad3 and Chk1 protein kinases defines different checkpoint responses.
9766667 1998 Inhibition of phosphoinositide 3-kinase related kinases by the radiosensitizing agent wortmannin.
9765199 1998 The complexity of p53 modulation: emerging patterns from divergent signals.
9733515 1998 Activation of the ATM kinase by ionizing radiation and phosphorylation of p53.
9636169 1998 Protein kinase mutants of human ATR increase sensitivity to UV and ionizing radiation and abrogate cell cycle checkpoint control.
9427750 1998 Overexpression of a kinase-inactive ATR protein causes sensitivity to DNA-damaging agents and defects in cell cycle checkpoints.
8978690 1996 The Schizosaccharomyces pombe rad3 checkpoint gene.
8843195 1996 The Atr and Atm protein kinases associate with different sites along meiotically pairing chromosomes.
8610130 1996 cDNA cloning and gene mapping of a candidate human cell cycle checkpoint protein.