Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.86
PubTator Score 7.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 4.1e-04
osteosarcoma -1.423 1.4e-03

Synonym

Accession Q8N5M1 A6NDE5 A8K2J2 Q6XYC7
Symbols ATP12
ATP12p
LP3663
MC5DN1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

Protein-protein Interaction (6)

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20167577 Two possible dementia susceptibility genes including ATPAF2 and TOM1L2 near SREBF1 locus were identified.
20167577 Observational study of gene-disease association. (HuGE Navigator)
19933271 Data show that wild type human Atp12p rescues the respiratory defect of a yeast ATP12 deletion mutant (Deltaatp12).

AA Sequence

MWRSCLRLRDGGRRLLNRPAGGPSASMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEGGFEINLDHRK      1 - 70
LKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTI     71 - 140
CYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYNTWALQGIEFV    141 - 210
AAQLKSMVLTLGLIDLRLTVEQAVLLSRLEEEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHLCSEST    211 - 280
TVKHKLLKE                                                                 281 - 289
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
19933271 2010 Defining the pathogenesis of the human Atp12p W94R mutation using a Saccharomyces cerevisiae yeast model.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16381901 2006 The LIFEdb database in 2006.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14757859 2004 Respiratory chain complex V deficiency due to a mutation in the assembly gene ATP12.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
11410595 2001 Atp11p and Atp12p are assembly factors for the F(1)-ATPase in human mitochondria.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.