Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.18
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 3.3e-02
ependymoma -2.000 7.1e-03
oligodendroglioma -1.800 1.1e-02
glioblastoma -2.100 7.2e-06
osteosarcoma -1.459 7.2e-05
atypical teratoid / rhabdoid tumor -1.500 2.3e-05
medulloblastoma, large-cell -1.300 9.8e-04
primitive neuroectodermal tumor -1.200 3.9e-03
pancreatic ductal adenocarcinoma liver m... -1.445 1.3e-02
tuberculosis 1.100 1.7e-06
ulcerative colitis -1.200 2.6e-04
adult high grade glioma -1.900 1.0e-05
pilocytic astrocytoma -1.600 1.8e-06
Pick disease -1.500 4.6e-04
ovarian cancer 1.700 1.2e-03

Synonym

Accession Q5TC12 B1AQW7 B7Z7D6 B7Z7I6 Q9H6E3
Symbols ATP11
ATP11p

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (3)

PMID Text
21696813 Asthma was found to be associated with a cluster of SNPs and SNP haplotypes containing the ATPAF1 gene
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAE      1 - 70
LQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTK     71 - 140
DKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFF    141 - 210
VGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFY    211 - 280
ATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT                          281 - 328
//

Text Mined References (14)

PMID Year Title
21696813 2011 Identification of ATPAF1 as a novel candidate gene for asthma in children.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20579638 2010 OGFOD1, a member of the 2-oxoglutarate and iron dependent dioxygenase family, functions in ischemic signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15789402 2005 Assembly factors of F1FO-ATP synthase across genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12965202 2003 Differential expression of ATPAF1 and ATPAF2 genes encoding F(1)-ATPase assembly proteins in mouse tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206899 2002 Atp11p and Atp12p are chaperones for F(1)-ATPase biogenesis in mitochondria.
11410595 2001 Atp11p and Atp12p are assembly factors for the F(1)-ATPase in human mitochondria.