Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.22
PubTator Score 2.01

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -3.300 6.7e-09
psoriasis -1.300 2.2e-03
osteosarcoma -3.913 2.6e-04
interstitial cystitis 1.100 1.8e-03
pilocytic astrocytoma 1.300 2.2e-07
non primary Sjogren syndrome sicca -1.200 2.5e-02
lung carcinoma -1.200 1.2e-17
spina bifida 1.676 3.0e-02
ductal carcinoma in situ -1.200 2.1e-03
invasive ductal carcinoma -1.500 1.0e-03
Gaucher disease type 3 -1.500 4.1e-02

Gene RIF (3)

PMID Text
26473621 ATP8B4 gene was associated with a significant increase in the risk of systemic sclerosis. ATP8B4 is overexpressed in systemic sclerosis patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17998437 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MFCSEKKLREVERIVKANDREYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYFLCLLILQLIP      1 - 70
EISSLTWFTTIVPLVLVITMTAVKDATDDYFRHKSDNQVNNRQSEVLINSKLQNEKWMNVKVGDIIKLEN     71 - 140
NQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRHALSVTSELGADISRLAGFDGIVVCEVPNNKLDK    141 - 210
FMGILSWKDSKHSLNNEKIILRGCILRNTSWCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWI    211 - 280
FGFLICLGIILAIGNSIWESQTGDQFRTFLFWNEGEKSSVFSGFLTFWSYIIILNTVVPISLYVSVEVIR    281 - 350
LGHSYFINWDRKMYYSRKAIPAVARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKRCSINGRIYGEVHDD    351 - 420
LDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELIYQ    421 - 490
VQSPDEGALVTAARNFGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNTRKRMSVIVRNPEGQIKLYSK    491 - 560
GADTILFEKLHPSNEVLLSLTSDHLSEFAGEGLRTLAIAYRDLDDKYFKEWHKMLEDANAATEERDERIA    561 - 630
GLYEEIERDLMLLGATAVEDKLQEGVIETVTSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFV    631 - 700
IAGNNAVEVREELRKAKQNLFGQNRNFSNGHVVCEKKQQLELDSIVEETITGDYALIINGHSLAHALESD    701 - 770
VKNDLLELACMCKTVICCRVTPLQKAQVVELVKKYRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQA    771 - 840
VLASDYSFAQFRYLQRLLLVHGRWSYFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLF    841 - 910
NIVYTSLPVLAMGIFDQDVSDQNSVDCPQLYKPGQLNLLFNKRKFFICVLHGIYTSLVLFFIPYGAFYNV    911 - 980
AGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTFINHVFIWGSIAIYFSILFTMHSNGIFGIFPN    981 - 1050
QFPFVGNARHSLTQKCIWLVILLTTVASVMPVVAFRFLKVDLYPTLSDQIRRWQKAQKKARPPSSRRPRT   1051 - 1120
RRSSSRRSGYAFAHQEGYGELITSGKNMRAKNPPPTSGLEKTHYNSTSWIENLCKKTTDTVSSFSQDKTV   1121 - 1190
KL                                                                       1191 - 1192
//

Text Mined References (13)

PMID Year Title
26473621 2016 Identification of Rare Variants in ATP8B4 as a Risk Factor for Systemic Sclerosis by Whole-Exome Sequencing.
23087808 2012 Translocation t(11;14) (q13;q32) and genomic imbalances in multi-ethnic multiple myeloma patients: a Malaysian study.
20961850 2010 CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17998437 2008 Candidate single-nucleotide polymorphisms from a genomewide association study of Alzheimer disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880872 2003 FIC1, a P-type ATPase linked to cholestatic liver disease, has homologues (ATP8B2 and ATP8B3) expressed throughout the body.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
11015572 1999 Differential expression of putative transbilayer amphipath transporters.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.