Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.62
PubTator Score 119.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.500 1.7e-03
ependymoma -4.000 7.6e-28
oligodendroglioma -2.300 2.4e-03
psoriasis -1.300 2.9e-02
glioblastoma -3.900 8.3e-08
osteosarcoma 1.484 5.4e-03
sonic hedgehog group medulloblastoma -2.800 5.5e-07
atypical teratoid / rhabdoid tumor -3.400 2.0e-07
medulloblastoma, large-cell -3.000 1.6e-03
primitive neuroectodermal tumor -2.400 5.3e-04
non-small cell lung cancer -1.208 5.5e-08
lung cancer -2.500 4.6e-05
pediatric high grade glioma -3.500 2.2e-10
pilocytic astrocytoma -2.000 1.4e-05
lung adenocarcinoma -1.500 6.4e-06
lung carcinoma 6.200 4.8e-78

Gene RIF (4)

PMID Text
22892528 ATP8A2 is involved in the development of the cerebro-cerebellar structures required for posture and gait.
21454556 CDC50A is the beta-subunit of ATP8A2 and is crucial for the correct folding, stable expression, export from endoplasmic reticulum, and phosphatidylserine flippase activity of ATP8A2
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19778899 P4-ATPase Atp8a2 is a phosphatidylserine flippase in photoreceptor disc membranes

AA Sequence

MSRATSVGDQLEAPARTIYLNQPHLNKFRDNQISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIP      1 - 70
DVSPTGRYTTLVPLIIILTIAGIKEIVEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVVN     71 - 140
GQYLPADVVLLSSSEPQAMCYVETANLDGETNLKIRQGLSHTADMQTREVLMKLSGTIECEGPNRHLYDF    141 - 210
TGNLNLDGKSLVALGPDQILLRGTQLRNTQWVFGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVL    211 - 280
FGILLVMALVSSAGALYWNRSHGEKNWYIKKMDTTSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQA    281 - 350
LFINWDTDMYYIGNDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREP    351 - 420
SSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDNIIYQASSPDEAA    421 - 490
LVKGAKKLGFVFTARTPFSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRTPSGRLRLYCKGADNVIFE    491 - 560
RLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASTILKDRAQRLEECYEIIEKN    561 - 630
LLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATR    631 - 700
AAITQHCTDLGNLLGKENDVALIIDGHTLKYALSFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKK    701 - 770
RVKAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCIL    771 - 840
YCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYKIT    841 - 910
QNGEGFNTKVFWGHCINALVHSLILFWFPMKALEHDTVLTSGHATDYLFVGNIVYTYVVVTVCLKAGLET    911 - 980
TAWTKFSHLAVWGSMLTWLVFFGIYSTIWPTIPIAPDMRGQATMVLSSAHFWLGLFLVPTACLIEDVAWR    981 - 1050
AAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPHGYA   1051 - 1120
FSQEEHGAVSQEEVIRAYDTTKKKSRKK                                             1121 - 1148
//

Text Mined References (17)

PMID Year Title
26240149 2015 Characterization of P4 ATPase Phospholipid Translocases (Flippases) in Human and Rat Pancreatic Beta Cells: THEIR GENE SILENCING INHIBITS INSULIN SECRETION.
24077738 2014 P4-ATPases: lipid flippases in cell membranes.
23579954 2013 P4 ATPases: flippases in health and disease.
23568457 2013 Genetic variants associated with disordered eating.
22892528 2013 Missense mutation in the ATPase, aminophospholipid transporter protein ATP8A2 is associated with cerebellar atrophy and quadrupedal locomotion.
21454556 2011 Critical role of the beta-subunit CDC50A in the stable expression, assembly, subcellular localization, and lipid transport activity of the P4-ATPase ATP8A2.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20683487 2010 Disruption of the ATP8A2 gene in a patient with a t(10;13) de novo balanced translocation and a severe neurological phenotype.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19778899 2009 Localization, purification, and functional reconstitution of the P4-ATPase Atp8a2, a phosphatidylserine flippase in photoreceptor disc membranes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11015572 1999 Differential expression of putative transbilayer amphipath transporters.
10551800 1999 Changes in levels of normal ML-1 gene transcripts associated with the conversion of human nontumorigenic to tumorigenic phenotypes.