Property Summary

NCBI Gene PubMed Count 32
PubMed Score 6.10
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.344 2.9e-03
astrocytic glioma -1.200 2.9e-02
oligodendroglioma -1.100 3.7e-02
psoriasis 2.200 4.2e-05
osteosarcoma 2.430 7.8e-06
pancreatic ductal adenocarcinoma liver m... -1.308 9.8e-04
intraductal papillary-mucinous neoplasm ... 1.200 9.9e-03
Parkinson's disease -1.100 8.7e-03
subependymal giant cell astrocytoma 1.286 1.3e-02
ovarian cancer 1.400 3.0e-03

Gene RIF (3)

PMID Text
26312577 genome-wide association study in population in China: Data suggest 4 SNPs upstream of ATP6V1G1 (rs10817638, rs7851259, rs10982287, rs4979427) are associated (in bivariate manner) with age at menarche and bone density. [includes META-ANALYSIS]
26180254 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit
24762812 RILP regulates the activity of the V-ATPase through its interaction with V1G1.

AA Sequence

MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS      1 - 70
TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING                           71 - 118
//

Text Mined References (35)

PMID Year Title
26312577 2015 Bivariate Genome-Wide Association Study Implicates ATP6V1G1 as a Novel Pleiotropic Locus Underlying Osteoporosis and Age at Menarche.
26180254 2015 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24762812 2014 RILP regulates vacuolar ATPase through interaction with the V1G1 subunit.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17897319 2007 Integral and associated lysosomal membrane proteins.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17360703 2007 V1 and V0 domains of the human H+-ATPase are linked by an interaction between the G and a subunits.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16226257 2005 Binding interaction of SARS coronavirus 3CL(pro) protease with vacuolar-H+ ATPase G1 subunit.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384298 2002 Molecular cloning and characterization of novel tissue-specific isoforms of the human vacuolar H(+)-ATPase C, G and d subunits, and their evaluation in autosomal recessive distal renal tubular acidosis.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.