Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.76
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYI      1 - 70
AEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR                          71 - 119
//

Text Mined References (27)

PMID Year Title