Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.53
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 2010 1.9e-07
osteosarcoma 7950 1.8e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.206 1.8e-05
tuberculosis 1.300 1.9e-07

Gene RIF (1)

AA Sequence

MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI      1 - 70
LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQD     71 - 140
LLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKQKMPE    141 - 210
IRMALFGANTNRKFFI                                                          211 - 226
//

Text Mined References (16)

PMID Year Title