Property Summary

NCBI Gene PubMed Count 38
PubMed Score 10.32
PubTator Score 173.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.800 6.5e-03
ependymoma -1.900 9.4e-03
oligodendroglioma -1.100 3.9e-02
medulloblastoma -1.400 3.9e-08
atypical teratoid / rhabdoid tumor -1.900 1.3e-08
glioblastoma -1.400 2.9e-05
medulloblastoma, large-cell -1.900 1.2e-06
primitive neuroectodermal tumor -1.500 2.6e-05
adult high grade glioma -1.200 2.4e-06
Pick disease -1.400 3.9e-04
ovarian cancer 1.300 3.2e-04

Gene RIF (6)

PMID Text
25072283 Low-grade PanIN lesions with typical columnar morphology displayed diffuse labeling of the V1E subunit. In advanced lesions it was found along the basolateral membranes.
22395867 The genes CECR2, SLC25A18 and ATP6V1E1, mapping within the critical region for cat eye syndrome (CES), may be responsible for anorectal, renal and preauricular anomalies in patients with CES.
16155006 HuR shows increased binding to some V-ATPase mRNAs during ATP depletion; siRNA-mediated knockdown of HuR results in diminished V-ATPase expression
12163484 Data demonstrate the physiological significance of the interaction between the E and H subunits of V-ATPase and extend previous studies on the arrangement of subunits on the peripheral stalk of V-ATPase.
11560919 The mouse V-ATPase E may participate in the regulation of the mSos1-dependent Rac1 signaling pathway involved in growth factor receptor-mediated cell growth control.
10748165 Rat vacuolar H(+)ATPase associates with NHE-RF (Na(+)/H(+) exchanger regulatory factor); the E subunit was co-immunoprecipitated from rat kidney cytosol with NHE-RF antibodies.

AA Sequence

MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI      1 - 70
QMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQD     71 - 140
FPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPE    141 - 210
VRGALFGANANRKFLD                                                          211 - 226
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25072283 2014 Polarization of the vacuolar adenosine triphosphatase delineates a transition to high-grade pancreatic intraepithelial neoplasm lesions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
22395867 2012 A 600?kb triplication in the cat eye syndrome critical region causes anorectal, renal and preauricular anomalies in a three-generation family.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21269460 2011 Initial characterization of the human central proteome.
20717956 2011 Rab11b and its effector Rip11 regulate the acidosis-induced traffic of V-ATPase in salivary ducts.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17897319 2007 Integral and associated lysosomal membrane proteins.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16196101 2005 Proteomic identification of the TRAF6 regulation of vacuolar ATPase for osteoclast function.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16155006 2005 HuR stabilizes vacuolar H+-translocating ATPase mRNA during cellular energy depletion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163484 2002 The amino-terminal domain of the E subunit of vacuolar H(+)-ATPase (V-ATPase) interacts with the H subunit and is required for V-ATPase function.
12036578 2002 A human gene, ATP6E1, encoding a testis-specific isoform of H(+)-ATPase subunit E.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
11560919 2001 The Sos1-Rac1 signaling. Possible involvement of a vacuolar H(+)-ATPase E subunit.
11399750 2001 Interaction between aldolase and vacuolar H+-ATPase: evidence for direct coupling of glycolysis to the ATP-hydrolyzing proton pump.
11381032 2001 Analysis of the cat eye syndrome critical region in humans and the region of conserved synteny in mice: a search for candidate genes at or near the human chromosome 22 pericentromere.
10915794 2000 The amino-terminal domain of the B subunit of vacuolar H+-ATPase contains a filamentous actin binding site.
10748165 2000 The B1 subunit of the H+ATPase is a PDZ domain-binding protein. Colocalization with NHE-RF in renal B-intercalated cells.
10591208 1999 The DNA sequence of human chromosome 22.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9405660 1997 Comparative mapping of the human 22q11 chromosomal region and the orthologous region in mice reveals complex changes in gene organization.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
8250920 1993 Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase.
8004105 1994 The E subunit of vacuolar H(+)-ATPase localizes close to the centromere on human chromosome 22.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.
1533641 1992 Immunologic evidence that vacuolar H+ ATPases with heterogeneous forms of Mr = 31,000 subunit have different membrane distributions in mammalian kidney.