Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.22
PubTator Score 4.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.399 2.9e-03
astrocytic glioma -1.600 8.7e-03
ependymoma -1.100 3.7e-02
oligodendroglioma -1.300 3.1e-02
osteosarcoma -1.764 4.9e-08
medulloblastoma -1.600 2.6e-09
atypical teratoid / rhabdoid tumor -1.200 7.8e-05
glioblastoma -1.300 1.2e-04
medulloblastoma, large-cell -2.000 5.8e-06
primitive neuroectodermal tumor -1.100 4.1e-04
tuberculosis and treatment for 6 months -1.500 4.4e-03
intraductal papillary-mucinous adenoma (... 1.200 3.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
colon cancer -1.500 4.5e-03
lung cancer -1.600 6.4e-04
Breast cancer 2.800 3.3e-02
ovarian cancer 2.800 3.3e-05
dermatomyositis 1.200 1.0e-03

Gene RIF (3)

PMID Text
25006744 Top single-nucleotide polymorphism rs9590614 in VMA8 is located within genes that function in cell-cell signaling and cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLA      1 - 70
EAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAK     71 - 140
AVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKK    141 - 210
ILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE                                     211 - 247
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21844891 2012 A SNX10/V-ATPase pathway regulates ciliogenesis in vitro and in vivo.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18752060 2008 The d subunit plays a central role in human vacuolar H(+)-ATPases.
17897319 2007 Integral and associated lysosomal membrane proteins.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11913976 2002 Yeast two-hybrid screening identifies binding partners of human Tom34 that have ATPase activity and form a complex with Tom34 in the cytosol.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
11435709 2001 cDNA cloning, chromosomal localization and evolutionary analysis of mouse vacuolar ATPase subunit D, Atp6m.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.