Property Summary

NCBI Gene PubMed Count 31
PubMed Score 21.67
PubTator Score 12.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.200 9.4e-03
astrocytic glioma -1.500 8.0e-03
Astrocytoma, Pilocytic -1.200 2.7e-04
atypical teratoid / rhabdoid tumor -2.400 5.0e-09
Breast cancer 3.700 2.2e-02
breast carcinoma 1.100 2.9e-21
ependymoma -1.700 6.4e-03
Gaucher disease type 1 -1.100 1.8e-02
glioblastoma -1.300 9.7e-05
group 3 medulloblastoma -1.500 5.5e-03
hepatocellular carcinoma 1.200 1.7e-04
intraductal papillary-mucinous adenoma (... 1.200 3.2e-02
intraductal papillary-mucinous carcinoma... 1.400 1.9e-02
invasive ductal carcinoma 1.100 2.8e-02
lung adenocarcinoma 1.554 7.1e-08
lung cancer 1.500 1.8e-03
medulloblastoma, large-cell -1.700 7.0e-05
oligodendroglioma -1.100 7.4e-13
osteosarcoma 1.439 8.2e-03
ovarian cancer -1.500 1.3e-04
pancreatic ductal adenocarcinoma liver m... -2.032 4.5e-03
Pick disease -1.100 1.2e-03
primitive neuroectodermal tumor -1.200 4.7e-05
psoriasis -1.600 1.9e-03
tuberculosis -1.900 2.0e-04

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVK      1 - 70
KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRA     71 - 140
SAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVP    141 - 210
RSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLV    211 - 280
RWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAII    281 - 350
DAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK                                          351 - 382
//

Text Mined References (37)

PMID Year Title