Property Summary

NCBI Gene PubMed Count 31
PubMed Score 20.09
PubTator Score 12.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.7e-04
astrocytic glioma -1.500 8.0e-03
ependymoma -1.700 6.4e-03
psoriasis -1.600 1.9e-03
glioblastoma -2.200 3.2e-06
oligodendroglioma -1.100 7.4e-13
osteosarcoma 2.602 8.6e-04
medulloblastoma -2.300 1.7e-06
atypical teratoid / rhabdoid tumor -2.400 5.0e-09
medulloblastoma, large-cell -3.000 1.2e-06
primitive neuroectodermal tumor -1.700 2.5e-05
pancreatic ductal adenocarcinoma liver m... -2.032 4.5e-03
tuberculosis and treatment for 6 months -3.400 1.2e-04
intraductal papillary-mucinous adenoma (... 1.200 3.2e-02
intraductal papillary-mucinous carcinoma... 1.400 1.9e-02
lung cancer 1.500 1.8e-03
Breast cancer 3.700 2.2e-02
adult high grade glioma -1.900 1.0e-04
pilocytic astrocytoma -1.200 2.8e-04
lung adenocarcinoma 1.554 7.1e-08
breast carcinoma 1.200 8.3e-15
Pick disease -1.100 1.2e-03
invasive ductal carcinoma 1.300 2.1e-02
ovarian cancer 2.400 9.3e-06
Gaucher disease type 1 -1.100 1.8e-02

Gene RIF (6)

PMID Text
25901422 We assessed ATPaseC1 expression in a sample of oral squamous cell carcinoma using tissue microarrays to analyze the relation between ATPaseC1 expression and clinical, histopathological and prognostic parameters.
24454753 results of our study suggest that high expression of Atp6v1c1 affects the actin structure of cancer cells such that it facilitates breast cancer metastasis
21526910 Immunohistochemical localization of C1 subunit of V-ATPase (ATPase C1) in oral squamous cell cancer and normal oral mucosa.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12890556 proximal promoter region contains cis-acting elements required for expression in cancer cells

AA Sequence

MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVK      1 - 70
KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRA     71 - 140
SAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVP    141 - 210
RSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLV    211 - 280
RWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAII    281 - 350
DAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK                                          351 - 382
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25901422 2015 The use of tissue microarrays for semiquantitative evaluation of ATPaseC1 expression is ineffective.
24454753 2014 Atp6v1c1 may regulate filament actin arrangement in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21526910 2012 Immunohistochemical localization of C1 subunit of V-ATPase (ATPase C1) in oral squamous cell cancer and normal oral mucosa.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17897319 2007 Integral and associated lysosomal membrane proteins.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16415858 2006 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12890556 2003 Structural and functional characterization of two human V-ATPase subunit gene promoters.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384298 2002 Molecular cloning and characterization of novel tissue-specific isoforms of the human vacuolar H(+)-ATPase C, G and d subunits, and their evaluation in autosomal recessive distal renal tubular acidosis.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11707601 2001 BAALC, the human member of a novel mammalian neuroectoderm gene lineage, is implicated in hematopoiesis and acute leukemia.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
8250920 1993 Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.
2147024 1990 Molecular cloning of cDNA encoding the C subunit of H(+)-ATPase from bovine chromaffin granules.