Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.67
PubTator Score 5.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 2.172 1.9e-05
astrocytoma 1.300 1.2e-02
glioblastoma 1.800 3.4e-05
ependymoma 1.300 3.3e-16
medulloblastoma, large-cell -1.400 1.3e-04
primary pancreatic ductal adenocarcinoma 1.245 1.8e-03
Breast cancer 2.900 3.0e-02
pediatric high grade glioma 1.500 1.5e-06
pilocytic astrocytoma 1.500 3.0e-10
subependymal giant cell astrocytoma 1.756 5.7e-03
ovarian cancer 2.400 5.2e-06
Down syndrome 1.300 2.5e-04
pancreatic cancer 1.200 1.5e-03
dermatomyositis 1.500 8.3e-04

Gene RIF (2)

PMID Text
17576770 there is an important role for physical association between aldolase and the A, B and E subunits of V-ATPase in the regulation of the proton pump
12163484 Data demonstrate the physiological significance of the interaction between the E and H subunits of V-ATPase and extend previous studies on the arrangement of subunits on the peripheral stalk of V-ATPase.

AA Sequence

MAYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN      1 - 70
ETIWYLKYHWP                                                                71 - 81
//

Text Mined References (22)

PMID Year Title
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17576770 2007 Physical interaction between aldolase and vacuolar H+-ATPase is essential for the assembly and activity of the proton pump.
17350184 2007 Molecular cloning and characterization of a novel form of the human vacuolar H+-ATPase e-subunit: an essential proton pump component.
15906478 2005 Full-length coding sequences and mapping of porcine ATP6VOE and ATP5G1 genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970230 2004 The yeast vacuolar proton-translocating ATPase contains a subunit homologous to the Manduca sexta and bovine e subunits that is essential for function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163484 2002 The amino-terminal domain of the E subunit of vacuolar H(+)-ATPase (V-ATPase) interacts with the H subunit and is required for V-ATPase function.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9556572 1998 Identification and characterization of a novel 9.2-kDa membrane sector-associated protein of vacuolar proton-ATPase from chromaffin granules.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.