Property Summary

NCBI Gene PubMed Count 45
PubMed Score 72.64
PubTator Score 21.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Osteopetrosis 40 3.046 1.5

Expression

Gene RIF (14)

PMID Text
26110566 Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer.
24695574 A role for ATP6V0C in maintaining constitutive and stress-induced ALP function.
24385903 siRNA knockdown of ATP6V0C resulted in almost complete loss of infectious virus production, suggesting that an human cytomegalovirus microRNA targets a crucial cellular factor required for virus replication.
24254321 The consequences of pharmacological inhibition of v-ATPase (by concanamycin) on proliferation, migration, VEGF-receptor 2 (VEGFR2) trafficking and signaling, as well as Notch-mediated transcription in endothelial cells, were examined.
24166050 Results show that inhibition of V-ATPase by archazolid reduces the activity of prometastatic proteases like cathepsin B in vitro and in vivo.
22991218 results contribute to the conclusion that LASS2/TMSG1 could regulate V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPase
22829766 data suggest that the bacterial effector VepA targets subunit c of V-ATPase and induces the rupture of host cell lysosomes and subsequent cell death.
21433058 ATP6L has a protective role against SNP-induced autophagic cell death via inhibition of JNK and p38 in GSH-depleted glial cells.
21087195 Novel recessive myoclonic epilepsy candidate gene myoclonic epilepsy , but no mutation was found.
19875448 HRG-1 regulates V-ATPase activity, which is essential for endosomal acidification, heme binding, and receptor trafficking in mammalian cells.
19299075 tumor acidity has a role in regulating inhibits the expression of ATP6L mRNA and protein in breast tumor cells
19058789 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15466867 16K expression inhibits beta(1) integrin surface expression and spreading on matrix by a novel mechanism that results in reduced levels of functional beta(1) integrin

AA Sequence

MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGL      1 - 70
VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV     71 - 140
LGLYGLIVALILSTK                                                           141 - 155
//

Text Mined References (47)

PMID Year Title
26110566 2015 AGPAT9 suppresses cell growth, invasion and metastasis by counteracting acidic tumor microenvironment through KLF4/LASS2/V-ATPase signaling pathway in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24695574 2014 ATP6V0C knockdown in neuroblastoma cells alters autophagy-lysosome pathway function and metabolism of proteins that accumulate in neurodegenerative disease.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24385903 2013 Systematic microRNA analysis identifies ATP6V0C as an essential host factor for human cytomegalovirus replication.
24254321 2014 Regulation of endothelial signaling and migration by v-ATPase.
24166050 2014 V-ATPase inhibition by archazolid leads to lysosomal dysfunction resulting in impaired cathepsin B activation in vivo.
22991218 2013 A novel tumor metastasis suppressor gene LASS2/TMSG1 interacts with vacuolar ATPase through its homeodomain.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
22829766 2012 A cytotoxic type III secretion effector of Vibrio parahaemolyticus targets vacuolar H+-ATPase subunit c and ruptures host cell lysosomes.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21433058 2011 Vacuolar H+ -ATPase c protects glial cell death induced by sodium nitroprusside under glutathione-depleted condition.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21087195 2010 Early-onset progressive myoclonic epilepsy with dystonia mapping to 16pter-p13.3.
20093472 2010 Requirement of prorenin receptor and vacuolar H+-ATPase-mediated acidification for Wnt signaling.
19875448 2010 Heme-binding protein HRG-1 is induced by insulin-like growth factor I and associates with the vacuolar H+-ATPase to control endosomal pH and receptor trafficking.
19299075 2009 Small interfering RNA targeting the subunit ATP6L of proton pump V-ATPase overcomes chemoresistance of breast cancer cells.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18298843 2008 A novel brain-enriched E3 ubiquitin ligase RNF182 is up regulated in the brains of Alzheimer's patients and targets ATP6V0C for degradation.
17897319 2007 Integral and associated lysosomal membrane proteins.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466867 2004 Expression of the vacuolar H+-ATPase 16-kDa subunit results in the Triton X-100-insoluble aggregation of beta1 integrin and reduction of its cell surface expression.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438748 2002 Chromosomal localization of three vacuolar-H+ -ATPase 16 kDa subunit (ATP6V0C) genes in the murine genome.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
11543633 2001 Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
8741845 1996 Resorption-cycle-dependent polarization of mRNAs for different subunits of V-ATPase in bone-resorbing osteoclasts.
8250920 1993 Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase.
7636472 1995 Mapping of the intermolecular association of human T cell leukaemia/lymphotropic virus type I p12I and the vacuolar H+-ATPase 16 kDa subunit protein.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.
1709739 1991 CpG island in the region of an autosomal dominant polycystic kidney disease locus defines the 5' end of a gene encoding a putative proton channel.
1532310 1992 Vacuolar type H(+)-ATPase genes: presence of four genes including pseudogenes for the 16-kDa proteolipid subunit in the human genome.
1334459 1992 The BPV-1 E5 protein, the 16 kDa membrane pore-forming protein and the PDGF receptor exist in a complex that is dependent on hydrophobic transmembrane interactions.