Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.65
PubTator Score 5.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.194 4.4e-03
Multiple myeloma 1.603 1.0e-04
astrocytic glioma -1.100 4.1e-02
breast carcinoma 1.400 1.1e-05
diabetes mellitus -2.900 1.7e-03
Subcutaneous panniculitis-like T-cell ly... 1.300 3.0e-02
invasive ductal carcinoma 1.800 8.3e-04
acute myeloid leukemia 1.400 3.0e-02
ovarian cancer 1.900 2.6e-05

Gene RIF (4)

PMID Text
19460752 Knockdown of ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17576770 there is an important role for physical association between aldolase and the A, B and E subunits of V-ATPase in the regulation of the proton pump
15249206 These studies show a Na(+)- and HCO(3)(-)-independent pH(cyt) regulatory mechanism in HLMVE cells that is mediated by pmV-ATPases.
12890556 proximal promoter region contains cis-acting elements required for expression in cancer cells

AA Sequence

MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIY      1 - 70
ITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGA     71 - 140
GLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD         141 - 205
//

Text Mined References (20)

PMID Year Title
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17576770 2007 Physical interaction between aldolase and vacuolar H+-ATPase is essential for the assembly and activity of the proton pump.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15249206 2004 Plasmalemmal V-H(+)-ATPases regulate intracellular pH in human lung microvascular endothelial cells.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
12890556 2003 Structural and functional characterization of two human V-ATPase subunit gene promoters.
12788495 2003 Proton translocation driven by ATP hydrolysis in V-ATPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11836511 2002 The vacuolar (H+)-ATPases--nature's most versatile proton pumps.
10440860 1999 Animal plasma membrane energization by proton-motive V-ATPases.
10340843 1999 Introduction: V-ATPases 1992-1998.
10224039 1999 Structure and properties of the vacuolar (H+)-ATPases.
10221984 1999 Vacuolar and plasma membrane proton-adenosinetriphosphatases.
9653649 1998 Identification and characterization of the gene encoding a second proteolipid subunit of human vacuolar H(+)-ATPase (ATP6F).
9442887 1997 Structure, function and regulation of the vacuolar (H+)-ATPase.
9210392 1997 The vacuolar H+-ATPase: a universal proton pump of eukaryotes.