Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.74
PubTator Score 5.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.400 3.0e-02
astrocytic glioma -1.100 4.1e-02
breast carcinoma 1.400 1.1e-05
diabetes mellitus -1.600 2.3e-03
invasive ductal carcinoma 1.800 8.3e-04
Multiple myeloma 1.603 1.0e-04
ovarian cancer 1.900 2.6e-05
Subcutaneous panniculitis-like T-cell ly... 1.300 3.0e-02
Waldenstrons macroglobulinemia 1.194 4.4e-03

Gene RIF (4)

AA Sequence

MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIY      1 - 70
ITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGA     71 - 140
GLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD         141 - 205
//

Text Mined References (20)

PMID Year Title