Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.48
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.7e-06
psoriasis 6694 1.5e-03
lung cancer 4740 3.4e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 3.4e-02
osteosarcoma -1.088 3.7e-06
psoriasis 1.400 1.5e-03

 IMPC Phenotype (1)

 MGI Phenotype (1)

Gene RIF (2)

AA Sequence

MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWL      1 - 70
LRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDD     71 - 140
CLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLEL    141 - 210
KLQLK                                                                     211 - 215
//

Text Mined References (21)

PMID Year Title