Property Summary

NCBI Gene PubMed Count 34
PubMed Score 264.20
PubTator Score 122.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.149 2.8e-02
Multiple myeloma 1.758 5.1e-04
pancreatic ductal adenocarcinoma liver m... -1.759 8.2e-03
lung cancer 1.300 3.5e-03
Pneumonia -1.300 1.5e-02
ovarian cancer 1.700 9.3e-04

Gene RIF (15)

PMID Text
24124598 Over-expression of the ATP5J gene correlates with cell migration and 5-fluorouracil sensitivity in colorectal cancer.
22190034 HIV-1 Vpu is identified to have a physical interaction with ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6 (ATP5J) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22038518 CF6 plays a crucial role in the development of insulin resistance and hypertension
20953793 The phenotypic range of retinal, peripheral and central nervous system disease expression is characterized in a single family with NARP syndrome from the ATPase 6 m.8993T>C mtDNA point mutation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20811295 coupling factor 6 induces the development of systolic dysfunction and upregulation of nicotinamide adenine dinucleotide phosphate oxidase in the heart under the high-salt diet
19106112 Coupling factor 6 enhances Src-mediated responsiveness to angiotensin II in resistance arterioles and cells.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18243211 in vascular endothelial cells both CF6 (coupling factor 6) and Angiotensin II downregulate PECAM-1 (platelet/endothelial cell adhesion molecule) expression via activation of c-Src kinase
17456993 Increased CF6 may be responsible in part for decreased prostacyclin observed in coronary heart disease, in particular after PTCA and stent therapy. Potential risk factor for coronary heart disease.
16532470 T8993G allele causes severe extrapyramidal dysfunction and Leigh disease but there is no correlation between the degree of enzyme deficiency and the severity of the phenotype.
16230521 Membrane-bound ATP synthase functions as a receptor for CF6 and may have a previously unsuspected role in the genesis of hypertension by modulating the concentration of intracellular hydrogen.
15785006 Plasma CF6 elevated in patients with acute myocardial infarction. At 3 days, plasma CF6 correlated positively with plasma creatinine kinase peak value and correlated negatively with left ventricular ejection fraction.
15709156 Mutation analysis revealed the T9176C mutation in the mtATPase 6 gene (OMIM 516060) and the mutation load was above 90% in the patients with Leigh syndrome.
14633154 CF6 is a novel risk factor for ischemic heart disease in end-stage renal disease. Synergism of this peptide and asymmetric dimethylarginine might contribute to its occurrence presumably by inhibition of prostacyclin and nitric oxide production.

AA Sequence

MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQE      1 - 70
LERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA                                     71 - 108
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24124598 2013 Over-expression of the ATP5J gene correlates with cell migration and 5-fluorouracil sensitivity in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22038518 2012 Coupling factor 6-induced activation of ecto-F1F(o) complex induces insulin resistance, mild glucose intolerance and elevated blood pressure in mice.
21269460 2011 Initial characterization of the human central proteome.
20953793 2011 Heterogeneous patterns of tissue injury in NARP syndrome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20811295 2010 Overexpression of coupling factor 6 causes cardiac dysfunction under high-salt diet in mice.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19106112 2009 Coupling factor 6 enhances Src-mediated responsiveness to angiotensin II in resistance arterioles and cells.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18243211 2008 Coupling factor 6 downregulates platelet endothelial cell adhesion molecule-1 via c-Src activation and acts as a proatherogenic molecule.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17456993 2007 Plasma level of mitochondrial coupling factor 6 increases in patients with coronary heart disease.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16532470 2006 Clinical and biochemical characteristics in patients with a high mutant load of the mitochondrial T8993G/C mutations.
16230521 2005 Intracellular signaling for vasoconstrictor coupling factor 6: novel function of beta-subunit of ATP synthase as receptor.
15785006 2004 Plasma mitochondrial coupling factor 6 in patients with acute myocardial infarction.
15709156 2005 Transmission and prenatal diagnosis of the T9176C mitochondrial DNA mutation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
14633154 2003 Plasma concentration of coupling factor 6 and cardiovascular events in patients with end-stage renal disease.
12745923 Understanding ATP synthesis: structure and mechanism of the F1-ATPase (Review).
12628343 2003 Rotary protein motors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471886 2000 F1-ATPase: a highly efficient rotary ATP machine.
12110673 2002 A functionally active human F1F0 ATPase can be purified by immunocapture from heart tissue and fibroblast cell lines. Subunit structure and activity studies.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10830953 2000 The DNA sequence of human chromosome 21.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9732751 1982 Assignment of an oligomycin-resistance locus to human chromosome 10.
9461222 1998 Energy transduction in ATP synthase.
7698763 1994 Sequence analysis and mapping of a novel human mitochondrial ATP synthase subunit 9 cDNA (ATP5G3).
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.
1830479 1991 Molecular cloning of cDNA for the import precursor of human coupling factor 6 of H(+)-ATP synthase in mitochondria.
1825642 1991 Human mitochondrial ATP synthase: cloning cDNA for the nuclear-encoded precursor of coupling factor 6.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.