Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.14
PubTator Score 2.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
astrocytoma 1493 3.0e-03
Pneumonia 133 9.8e-03
Disease Target Count Z-score Confidence
Malignant hyperthermia 25 3.24 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytoma -1.100 3.0e-03
Pneumonia -1.100 9.8e-03

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E (ATP5I) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18060860 The inhibitory activity against mitochondria and F(1)F(0)-ATP synthase is not limited to atrazine but is likely to be applicable to other triazine-based compounds.
16682002 This is the first report identifying caspase-3 as a substrate protein of Hsp90.
11939412 results suggest that antisense of hAS-e can inhibit cell proliferation through the MAP kinase pathway

AA Sequence

MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK       1 - 69
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
18060860 2008 Atrazine binds to F1F0-ATP synthase and inhibits mitochondrial function in sperm.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16682002 2006 F1F0-ATP synthase functions as a co-chaperone of Hsp90-substrate protein complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
12745923 Understanding ATP synthesis: structure and mechanism of the F1-ATPase (Review).
12628343 2003 Rotary protein motors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471886 2000 F1-ATPase: a highly efficient rotary ATP machine.
12110673 2002 A functionally active human F1F0 ATPase can be purified by immunocapture from heart tissue and fibroblast cell lines. Subunit structure and activity studies.
11939412 2001 Antisense of ATP synthase subunit e inhibits the growth of human hepatocellular carcinoma cells.
10409428 1999 Gene expression in proliferating human erythroid cells.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9461222 1998 Energy transduction in ATP synthase.
8702853 1996 The e subunit gene of murine F1F0-ATP synthase. Genomic sequence, chromosomal mapping, and diet regulation.
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.