Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.20
PubTator Score 25.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 3.1e-02
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-03
lung cancer 1.400 1.6e-03
Multiple myeloma 1.169 8.6e-04
ovarian cancer 1.500 1.6e-03
pancreatic ductal adenocarcinoma liver m... -2.051 2.3e-02
Parkinson's disease -1.100 1.9e-02
Pick disease -1.200 1.2e-04
psoriasis -1.600 1.8e-03

Gene RIF (1)

AA Sequence

MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDID      1 - 70
TAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF     71 - 140
AM                                                                        141 - 142
//

Text Mined References (12)

PMID Year Title