Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.31
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.392 2.9e-03
Multiple myeloma 1.537 4.7e-04
osteosarcoma 1.165 5.5e-03
lung cancer 1.700 2.0e-04
ovarian cancer 2.300 5.0e-06

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDT      1 - 70
AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA     71 - 140
M//

Text Mined References (18)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
16541075 2006 The finished DNA sequence of human chromosome 12.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9461222 1998 Energy transduction in ATP synthase.
8485160 1993 Molecular cloning and sequence of two cDNAs for human subunit c of H(+)-ATP synthase in mitochondria.
8328972 1993 Sequences of members of the human gene family for the c subunit of mitochondrial ATP synthase.
7821789 1994 Construction of a human full-length cDNA bank.
7706317 1995 The expression of subunit c correlates with and thus may limit the biosynthesis of the mitochondrial F0F1-ATPase in brown adipose tissue.
7698763 1994 Sequence analysis and mapping of a novel human mitochondrial ATP synthase subunit 9 cDNA (ATP5G3).
2883974 1987 Human liver cDNA clones encoding proteolipid subunit 9 of the mitochondrial ATPase complex.