Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.47
PubTator Score 25.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 2.8e-03
Disease Target Count Z-score Confidence
Spindle cell hemangioma 16 3.66 1.8
Neuronal ceroid lipofuscinosis 28 3.332 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.200 2.8e-03

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19889836 The subunit c isoforms are nonredundant, because they differ functionally by their targeting peptides, which, in addition to mediating mitochondrial protein import, play a yet undiscovered role in respiratory chain maintenance.

AA Sequence

MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFI      1 - 70
GAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM         71 - 136
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19889836 2010 Novel role of ATPase subunit C targeting peptides beyond mitochondrial protein import.
16381901 2006 The LIFEdb database in 2006.
15906478 2005 Full-length coding sequences and mapping of porcine ATP6VOE and ATP5G1 genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9461222 1998 Energy transduction in ATP synthase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8485160 1993 Molecular cloning and sequence of two cDNAs for human subunit c of H(+)-ATP synthase in mitochondria.
8328972 1993 Sequences of members of the human gene family for the c subunit of mitochondrial ATP synthase.
7698763 1994 Sequence analysis and mapping of a novel human mitochondrial ATP synthase subunit 9 cDNA (ATP5G3).
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.
2883974 1987 Human liver cDNA clones encoding proteolipid subunit 9 of the mitochondrial ATPase complex.