Property Summary

NCBI Gene PubMed Count 27
PubMed Score 5.85
PubTator Score 1.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.522 3.2e-03
Multiple myeloma 2.057 4.1e-05
astrocytic glioma -1.500 1.2e-02
oligodendroglioma -1.500 1.6e-02
atypical teratoid / rhabdoid tumor -1.300 3.7e-05
medulloblastoma, large-cell -1.300 2.5e-04
breast carcinoma 1.200 9.7e-03
interstitial cystitis -1.200 1.0e-03
ulcerative colitis -1.200 2.9e-06
ovarian cancer 2.100 1.2e-03
pituitary cancer 1.300 2.8e-05

Gene RIF (7)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase, mitochondrial Fo complex, subunit B1 (ATP5F1) expression by HIV-1 Vpr in Vpr transduced macrophages
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase, mitochondrial Fo complex, subunit B1 (ATP5F1) expression by HIV-1 Vpr in Vpr transduced macrophages
20877624 Observational study of gene-disease association. (HuGE Navigator)
20038517 Down-regulation of mitochondrial ATPase by hypermethylation mechanism in chronic myeloid leukemia is associated with multidrug resistance.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19650768 Nitration of tyrosine residues 368 and 345 in the beta-subunit elicits FoF1-ATPase activity loss.
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPK      1 - 70
TGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQ     71 - 140
ASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRK    141 - 210
EQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM                            211 - 256
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20038517 2010 Down-regulation of mitochondrial ATPase by hypermethylation mechanism in chronic myeloid leukemia is associated with multidrug resistance.
19946888 2010 Defining the membrane proteome of NK cells.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19650768 2009 Nitration of tyrosine residues 368 and 345 in the beta-subunit elicits FoF1-ATPase activity loss.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19016746 2008 Identification of mitochondrial F(1)F(0)-ATP synthase interacting with galectin-3 in colon cancer cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110673 2002 A functionally active human F1F0 ATPase can be purified by immunocapture from heart tissue and fibroblast cell lines. Subunit structure and activity studies.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9461222 1998 Energy transduction in ATP synthase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7821789 1994 Construction of a human full-length cDNA bank.
7706317 1995 The expression of subunit c correlates with and thus may limit the biosynthesis of the mitochondrial F0F1-ATPase in brown adipose tissue.
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.
2883974 1987 Human liver cDNA clones encoding proteolipid subunit 9 of the mitochondrial ATPase complex.
2868890 1985 Two genes encoding the bovine mitochondrial ATP synthase proteolipid specify precursors with different import sequences and are expressed in a tissue-specific manner.
1831354 1991 Molecular cloning of cDNA for the import precursor of human subunit B of H(+)-ATP synthase in mitochondria.