Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.50
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count P-value
ovarian cancer 8491 1.1e-05
Multiple myeloma 1327 4.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.888 4.6e-03
ovarian cancer 2.000 1.1e-05

Gene RIF (2)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase, F1 complex, delta subunit (ATP5D) expression by HIV-1 Vpr in Vpr transduced macrophages
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ATP synthase, F1 complex, delta subunit (ATP5D) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGIL      1 - 70
AAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAE     71 - 140
LVGTADEATRAEIQIRIEANEALVKALE                                              141 - 168
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14749837 2004 Mechanically driven ATP synthesis by F1-ATPase.
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12887009 2003 ATP synthases: insights into their motor functions from sequence and structural analyses.
12539966 2002 Role of copper in mitochondrial biogenesis via interaction with ATP synthase and cytochrome c oxidase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110673 2002 A functionally active human F1F0 ATPase can be purified by immunocapture from heart tissue and fibroblast cell lines. Subunit structure and activity studies.
11533724 2001 ATP synthase--a marvellous rotary engine of the cell.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9657145 1998 F1-ATPase is a highly efficient molecular motor that rotates with discrete 120 degree steps.
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.
1531933 1992 Molecular cloning of an import precursor of the delta-subunit of the human mitochondrial ATP synthase complex.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.