Property Summary

NCBI Gene PubMed Count 28
PubMed Score 3.75
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 4.6e-05
Multiple myeloma 1327 3.3e-04
Waldenstrons macroglobulinemia 764 5.1e-03
lung cancer 4473 6.2e-03
Breast cancer 3098 2.5e-02

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.402 5.1e-03
Multiple myeloma 1.745 3.3e-04
lung cancer 1.100 6.2e-03
Breast cancer 2.700 2.5e-02
ovarian cancer 3.000 4.6e-05

Gene RIF (9)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (ATP5C1) is identified by yeast two-hybrid screen
23395605 Studies indicate that F1-ATPase (F1) is a rotary motor protein driven by ATP hydrolysis and the minimum complex of F1 for function as a rotary motor is the alpha3beta3gamma subcomplex.
23125841 The interaction of HIV-1 CA with human cellular ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 (ATP5C1) is identified by yeast two-hybrid screen
20877624 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
17686786 A report on the mechanism of exon skipping regulated by Fox-1, using the hF1gamma gene as a model system.
16385451 Observational study of gene-disease association. (HuGE Navigator)
11744705 These results demonstrated that the 5'-AGUUCCA-3' immediately downstream from ESE is a muscle-specific exonic splicing silencer (MS-ESS) responsible for exclusion of exon 9 in vivo and in vitro

AA Sequence

MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYG      1 - 70
LGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGI     71 - 140
LYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVA    141 - 210
SADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQ    211 - 280
AVITKELIEIISGAAALD                                                        281 - 298
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23395605 2013 Chemomechanical coupling mechanism of F(1)-ATPase: catalysis and torque generation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17686786 2007 Tissue-specific splicing regulator Fox-1 induces exon skipping by interfering E complex formation on the downstream intron of human F1gamma gene.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14749837 2004 Mechanically driven ATP synthesis by F1-ATPase.
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12887009 2003 ATP synthases: insights into their motor functions from sequence and structural analyses.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110673 2002 A functionally active human F1F0 ATPase can be purified by immunocapture from heart tissue and fibroblast cell lines. Subunit structure and activity studies.
11533724 2001 ATP synthase--a marvellous rotary engine of the cell.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9657145 1998 F1-ATPase is a highly efficient molecular motor that rotates with discrete 120 degree steps.
9461222 1998 Energy transduction in ATP synthase.
8227057 1993 Gene structure of human mitochondrial ATP synthase gamma-subunit. Tissue specificity produced by alternative RNA splicing.
8168843 1994 Chromosomal localization of genes required for the terminal steps of oxidative metabolism: alpha and gamma subunits of ATP synthase and the phosphate carrier.
8065448 1994 Structure at 2.8 A resolution of F1-ATPase from bovine heart mitochondria.
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.