Property Summary

NCBI Gene PubMed Count 69
PubMed Score 36.35
PubTator Score 34.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.292 4.7e-04
colon cancer -1.600 2.6e-02
lung cancer 1.900 7.0e-03
ovarian cancer 2.400 6.7e-06

Gene RIF (33)

PMID Text
26835708 Hypermethylation of ATPsyn-beta gene promoter is associated with a down-regulated mRNA expression and chemoresistance in AML patients.
26769832 Hemoglobin - a novel ligand of hepatocyte ectopic F1-ATPase
26526033 High mRNA levels of ATP5B are associated with glioblastoma.
26387949 PKA phosphorylates the ATPase inhibitory factor 1 and inactivates its capacity to bind and inhibit the mitochondrial H(+)-ATP synthase.
25311765 Our study suggested that positive beta2M expression or loss of ATP5B expression in tumor tissues is closely related to the metastasis, invasion, and poor-prognosis of gallbladder cancer.
24583174 No significant relationship was detected in the level of expression of the ATP2B4 and ATP5B genes in cancerous and healthy tissues of colorectal cancer patients.
24583174 ATP5B gene expressions were detected significantly higher in colorectal cancer samples.
24391795 Mitochondrial ATPsyn-beta expression and ATP synthase activity in relapsed/refractory acute myeloid leukemia patients were downregulated. This downregulated expression exhibited a positive correlation with the response to adriamycin of primary cells.
23874603 HIV-1 Tat upregulates the expression of ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide (ATP5B) in Jurkat cells
23523934 H2O2 may induce melanogenesis via the upregulation of PAH and activation of cAMP/p-CREB/MITF signaling by increasing intracellular cAMP levels through the induction of ATP5B.
23463654 Identification of ATP synthase as a lipid peroxide protein adduct in pancreatic islets from humans with and without type 2 diabetes mellitus.
23395605 Studies indicate that F1-ATPase (F1) is a rotary motor protein driven by ATP hydrolysis and the minimum complex of F1 for function as a rotary motor is the alpha3beta3gamma subcomplex.
23364796 HIV-1 Tat upregulates the expression of ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide (ATP5B) in Jurkat cells
22753871 Ectopic ATP synthase could be an accessible molecular target for inhibiting HIV-1 proliferation in vivo.
22433606 miR-127-5p targets the 3'UTR of beta-F1-ATPase mRNA (beta-mRNA) significantly reducing its translational efficiency.
22190034 HIV-1 Tat upregulates the expression of ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide (ATP5B) in Jurkat cells
22022619 Immunohistochemical analysis on a malignant mesothelioma tissue microarray showed cytoplasmic staining in 28 of 33 samples for vimentin and strong cytoplasmic staining in14 and weak in 16 samples for ss-F1-ATPase.
21481781 Data suggest that F1-ATPase catalytic site show the correlation between the phosphate binding and the tightening of the alphabeta-interface.
21193741 Disturbed flow and hypercholesterolemia synergistically promote gamma/delta T-lymphocyte activation by the membrane translocation of ATPSbeta in endothelial cells.
20705594 Results suggested that the ectopic expression of ATP synthase is a consequence of translocation from the mitochondria.
20663914 Molecular and functional studies indicate that the interaction of G3BP1 with beta-F1 mRNA inhibits its translation at the initiation level, supporting a role for G3BP1 in the glycolytic switch that occurs in cancer.
20067530 Co-immunoprecipitation experiments in the presence of alpha-methyl mannose verified the binding of Escherichia coli FimH to ATP synthase beta-subunit of human brain microvascular endothelial cells.
20028336 Findings of the present study support the hypothesis that down-regulation of the bioenergetic activity of mitochondria in human tumours is exerted by translation silencing of beta-F1-ATPase mRNA.
20012595 ATP synthase beta is phosphorylated at multiple sites and shows abnormal phosphorylation at specific sites in insulin-resistant muscle
19878569 Observational study of gene-disease association. (HuGE Navigator)
19567816 Low levels of beta-F1-ATPase are sensitive to combined platinum and 2-deoxy-D-glucose treatment in ovarian carcinoma.
18976975 Knockdown of ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide (ATP5B) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18284036 conclude that ATP synthase beta-subunit may have an important role in the glucolipotoxicity of islet cells
16996794 cholesterol exposure increased the level of ATPS-beta, along with Cav-1 and cholesterol in caveolae. the ectopic localization of ATPS-beta may participate in the energy balance of cells in response to the change in intracellular cholesterol levels.
16927672 This short review summarizes demonstrations of ATP5B (complex 5 of oxidative phosphorylation) subunit that show its movement under stereochemical alterations known to be induced during the binding of ADP and synthesis of ATP.
16890199 adenosine/uridine (AU)-rich element-binding proteins TIA-1 (T-cell intracellular antigen-1), TIAR (TIA-1-related protein), and HuR (Hu antigen R) interact with the beta-F1-ATPase mRNA through an AU-rich sequence located to the 3'-UTR.
16230521 Membrane-bound ATP synthase functions as a receptor for CF6 and may have a previously unsuspected role in the genesis of hypertension by modulating the concentration of intracellular hydrogen.
12511957 Ectopic beta-chain of ATP synthase is an apolipoprotein A-I receptor in hepatic HDL endocytosis

AA Sequence

MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAV      1 - 70
VDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPET     71 - 140
LGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGV    141 - 210
GKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARA    211 - 280
RVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTK    281 - 350
KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV    351 - 420
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKG    421 - 490
FQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS                                   491 - 529
//

Text Mined References (77)

PMID Year Title
26835708 2016 Hypermethylation of CpG sites at the promoter region is associated with deregulation of mitochondrial ATPsyn-? and chemoresistance in acute myeloid leukemia.
26769832 2015 Hemoglobin - a novel ligand of hepatocyte ectopic F1-ATPase.
26526033 2016 ATP5A1 and ATP5B are highly expressed in glioblastoma tumor cells and endothelial cells of microvascular proliferation.
26387949 2015 PKA Phosphorylates the ATPase Inhibitory Factor 1 and Inactivates Its Capacity to Bind and Inhibit the Mitochondrial H(+)-ATP Synthase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25311765 2015 ATP5b and ?2-microglobulin are predictive markers for the prognosis of patients with gallbladder cancer.
24583174 2014 Investigation of the association between ATP2B4 and ATP5B genes with colorectal cancer.
24391795 2013 Deregulation of mitochondrial ATPsyn-? in acute myeloid leukemia cells and with increased drug resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23523934 2013 Induction of ATP synthase ? by H2O2 induces melanogenesis by activating PAH and cAMP/CREB/MITF signaling in melanoma cells.
23463654 2013 Identification of ATP synthase as a lipid peroxide protein adduct in pancreatic islets from humans with and without type 2 diabetes mellitus.
23395605 2013 Chemomechanical coupling mechanism of F(1)-ATPase: catalysis and torque generation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22753871 2012 Ectopic ATP synthase facilitates transfer of HIV-1 from antigen-presenting cells to CD4(+) target cells.
22433606 2012 miR-127-5p targets the 3'UTR of human ?-F1-ATPase mRNA and inhibits its translation.
22022619 2011 Auto-antibodies to ?-F1-ATPase and vimentin in malignant mesothelioma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21481781 2011 Structural comparison of F1-ATPase: interplay among enzyme structures, catalysis, and rotations.
21269460 2011 Initial characterization of the human central proteome.
21193741 2011 A novel mechanism of ?/? T-lymphocyte and endothelial activation by shear stress: the role of ecto-ATP synthase ? chain.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20705594 2010 Mitochondrial F1Fo-ATP synthase translocates to cell surface in hepatocytes and has high activity in tumor-like acidic and hypoxic environment.
20663914 2010 Human G3BP1 interacts with beta-F1-ATPase mRNA and inhibits its translation.
20618440 2010 Proteomic and biochemical analysis of 14-3-3-binding proteins during C2-ceramide-induced apoptosis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20067530 2010 Human brain endothelial ATP synthase beta-subunit is mannose-insensitive binding target of FimH.
20028336 2010 Selective inhibition of beta-F1-ATPase mRNA translation in human tumours.
20012595 2010 Human ATP synthase beta is phosphorylated at multiple sites and shows abnormal phosphorylation at specific sites in insulin-resistant muscle.
19946888 2010 Defining the membrane proteome of NK cells.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19567816 2009 Ovarian carcinoma cells with low levels of beta-F1-ATPase are sensitive to combined platinum and 2-deoxy-D-glucose treatment.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18284036 Fatty acids and glucose in high concentration down-regulates ATP synthase beta-subunit protein expression in INS-1 cells.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17643490 2008 Ecto-F1-ATPase and MHC-class I close association on cell membranes.
17510399 2007 Angiostatin-like activity of a monoclonal antibody to the catalytic subunit of F1F0 ATP synthase.
16996794 2006 Cholesterol loading increases the translocation of ATP synthase beta chain into membrane caveolae in vascular endothelial cells.
16927672 2006 Assaying ATP synthase rotor activity.
16890199 2006 Control of the ATP synthase beta subunit expression by RNA-binding proteins TIA-1, TIAR, and HuR.
16751257 2006 Housekeeping genes for phylogenetic analysis of eutherian relationships.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16230521 2005 Intracellular signaling for vasoconstrictor coupling factor 6: novel function of beta-subunit of ATP synthase as receptor.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12511957 2003 Ectopic beta-chain of ATP synthase is an apolipoprotein A-I receptor in hepatic HDL endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206899 2002 Atp11p and Atp12p are chaperones for F(1)-ATPase biogenesis in mitochondria.
12110673 2002 A functionally active human F1F0 ATPase can be purified by immunocapture from heart tissue and fibroblast cell lines. Subunit structure and activity studies.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11410595 2001 Atp11p and Atp12p are assembly factors for the F(1)-ATPase in human mitochondria.
10077593 1999 Angiostatin binds ATP synthase on the surface of human endothelial cells.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9461222 1998 Energy transduction in ATP synthase.
8065448 1994 Structure at 2.8 A resolution of F1-ATPase from bovine heart mitochondria.
8006588 1994 A novel ligand in lymphocyte-mediated cytotoxicity: expression of the beta subunit of H+ transporting ATP synthase on the surface of tumor cell lines.
7798271 1994 ETS transcription factors regulate the expression of the gene for the human mitochondrial ATP synthase beta-subunit.
4517936 1973 A new concept for energy coupling in oxidative phosphorylation based on a molecular explanation of the oxygen exchange reactions.
2900241 1988 Gene structure of the human mitochondrial adenosine triphosphate synthase beta subunit.
2896550 1987 Sequence analysis of cDNAs for the human and bovine ATP synthase beta subunit: mitochondrial DNA genes sustain seventeen times more mutations.
2870059 1986 Human F1-ATPase: molecular cloning of cDNA for the beta subunit.
2687158 1989 The human ATP synthase beta subunit gene: sequence analysis, chromosome assignment, and differential expression.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.