Property Summary

NCBI Gene PubMed Count 67
PubMed Score 122.99
PubTator Score 53.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 1.4e-03
ovarian cancer -1.600 4.3e-05
pancreatic ductal adenocarcinoma liver m... -1.654 2.9e-02

Synonym

Accession P25705 A8K092 B4DY56 K7ENP3 Q53XX6 Q8IXV2 Q96FB4 Q96HW2 Q96IR6 Q9BTV8
Symbols OMR
ORM
ATPM
MOM2
ATP5A
hATP1
ATP5A1
MC5DN4
ATP5AL2
COXPD22
HEL-S-123m

Gene

Gene RIF (32)

AA Sequence

MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEE      1 - 70
TGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDV     71 - 140
PVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELI    141 - 210
IGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS    211 - 280
DAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE    281 - 350
RAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA    351 - 420
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYA    421 - 490
GVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFEA           491 - 553
//

Text Mined References (75)

PMID Year Title