Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5994.12
PubTator Score 382.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.700 5.3e-03
intraductal papillary-mucinous neoplasm ... -1.600 4.6e-02
pancreatic cancer -1.300 6.6e-04
ovarian cancer 1.100 7.9e-08

Protein-protein Interaction (1)

Gene RIF (6)

PMID Text
25678551 Homozygous missense mutation in the 14th exon of the ATP4A gene (c.2107C>T) is responsible for an atypical familial type I gastric neuroendocrine tumour.
24773566 ATP4A are found in nearly one-third of children with type 1 diabetes and more common among females. In this cross-sectional analysis, Hp infection was not associated with autoimmunity against parietal cells.
23317218 Downregulation of ATP4A gene is associated with gastric cancer.
19705497 cigarette smoke extract may cause an increase in the amount and activity of H,K-ATPase and smokers' susceptibility to development of peptic ulcer
18772363 study concludes that IL-1beta upregulates HKalpha transcription by inducing Sp1 binding to HKalpha Sp1 & NF-kappaB sites & that Helicobacter pylori perturbation of HKalpha expression is independent of Sp1-mediated basal HKalpha transcription
15962365 Gastric H+/K+-ATPase activities are not associated with H pylori status in patients with chronic gastritis.

AA Sequence

MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSA      1 - 70
TKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDN     71 - 140
LYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRV    141 - 210
PADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGR    211 - 280
IASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLAT    281 - 350
VTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ    351 - 420
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYRDRFPKVCE    421 - 490
IPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLG    491 - 560
ERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGD    561 - 630
HPITAKAIAASVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMV    631 - 700
FARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIV    701 - 770
TGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES    771 - 840
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQ    841 - 910
DSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIVFQVCIGCFL    911 - 980
CYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRCCPGSWWDQELYY                   981 - 1035
//

Text Mined References (18)

PMID Year Title
25678551 2015 Exome sequencing identifies ATP4A gene as responsible of an atypical familial type I gastric neuroendocrine tumour.
24773566 2014 ATP4A autoimmunity and Helicobacter pylori infection in children with type 1 diabetes.
23317218 2012 Intragenic DNA methylation concomitant with repression of ATP4B and ATP4A gene expression in gastric cancer is a potential serum biomarker.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
19705497 2009 Dysregulation of gastric H,K-ATPase by cigarette smoke extract.
18772363 2008 The role of Sp1 in IL-1beta and H. pylori-mediated regulation of H,K-ATPase gene transcription.
15962365 2005 Direct measurement of gastric H+/K+-ATPase activities in patients with or without Helicobacter pylori-associated chronic gastritis.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14743830 2004 Molecular and cellular regulation of the gastric proton pump.
10336993 1999 Species-specific distribution of alpha-galactosyl epitopes on the gastric H/K ATPase beta-subunit: relevance to the binding of human anti-parietal cell autoantibodies.
9017763 Proton pump inhibitors and acid-related diseases.
8279517 1993 Characterization of the beta-subunit of the H(+)-K(+)-ATPase using an inhibitory monoclonal antibody.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3036582 1987 The family of human Na+,K+-ATPase genes. No less than five genes and/or pseudogenes related to the alpha-subunit.
2176086 1990 Structure of the human gastric H,K-ATPase gene and comparison of the 5'-flanking sequences of the human and rat genes.
2160952 1990 Human gastric (H+ + K+)-ATPase gene. Similarity to (Na+ + K+)-ATPase genes in exon/intron organization but difference in control region.
1330887 1992 Mapping of the gene encoding the alpha-subunit of the human H+,K(+)-ATPase to chromosome 19q13.1 by fluorescent in situ hybridization.