Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.54
PubTator Score 15.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.0e-05
chronic rhinosinusitis -1.124 1.6e-02
ductal carcinoma in situ 2.200 9.7e-03
fibroadenoma 1.200 6.7e-04
interstitial cystitis -1.300 1.8e-02
intraductal papillary-mucinous adenoma (... 1.100 6.0e-03
intraductal papillary-mucinous carcinoma... 2.800 5.2e-04
intraductal papillary-mucinous neoplasm ... 2.000 2.7e-03
invasive ductal carcinoma 2.500 2.0e-03
lung cancer -1.300 3.7e-03
medulloblastoma, large-cell -1.300 3.8e-05
osteosarcoma -1.208 5.7e-03
pancreatic cancer 1.300 3.9e-04
psoriasis 1.500 9.4e-05

Gene RIF (12)

AA Sequence

MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFC      1 - 70
VDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQFKNPLILLLLGSALVSVLTKEYEDAVSIATA     71 - 140
VLVVVTVAFIQEYRSEKSLEELTKMVPPECNCLREGKLQHLLARELVPGDVVSLSIGDRIPADIRLTEVT    141 - 210
DLLVDESSFTGEAEPCSKTDSPLTGGGDLTTLSNIVFMGTLVQYGRGQGVVIGTGESSQFGEVFKMMQAE    211 - 280
ETPKTPLQKSMDRLGKQLTLFSFGIIGLIMLIGWSQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLG    281 - 350
VLRMAKKRVIVKKLPIVETLGCCSVLCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPS    351 - 420
KEVIKEFSNVSVGKLVEAGCVANNAVIRKNAVMGQPTEGALMALAMKMDLSDIKNSYIRKKEIPFSSEQK    421 - 490
WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRMGSLGLRVLALASG    491 - 560
PELGRLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMITGDALETALAIGRNIGLCNGKLQAMSGEEVD    561 - 630
SVEKGELADRVGKVSVFFRTSPKHKLKIIKALQESGAIVAMTGDGVNDAVALKSADIGIAMGQTGTDVSK    631 - 700
EAANMILVDDDFSAIMNAVEEGKGIFYNIKNFVRFQLSTSISALSLITLSTVFNLPSPLNAMQILWINII    701 - 770
MDGPPAQSLGVEPVDKDAFRQPPRSVRDTILSRALILKILMSAAIIISGTLFIFWKEMPEDRASTPRTTT    771 - 840
MTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLGSILGQLAVIYIPPLQRVFQTENLGALDLL    841 - 910
FLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV                                      911 - 946
//

Text Mined References (21)

PMID Year Title